Entry information : EguPrx116
Entry ID 11427
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-02-05 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-05 (Achraf Jemmat)
Peroxidase information: EguPrx116
Name EguPrx116
Class Class III peroxidase    [Orthogroup: Prx075]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx116
start..stop
S start..stop
EgrPrx116 651 0 1..321 1..321
EcamPrx115 597 0 1..321 1..322
EguPrx115 594 0 1..321 1..322
EgrPrx115 571 0 1..321 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 44364..44582 219 N° 2 44717..44908 192 N° 3 44998..45160 163 N° 4 45738..46129 392
join(44364..44582,44717..44908,44998..45160,45738..46129)


exon

Literature and cross-references EguPrx116
Protein sequence: EguPrx116
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (295)
PWM (Da):   %s   34390.02 (31757.6) Transmb domain:   %s   o10-32i
PI (pH):   %s   5.71 (5.36) Peptide Signal:   %s   cut: 27 range:27-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPSSFSKAILTLACVVLLIGGTSAQLSIFYYTETCPDLFPTVKSIVQEAIAKEARMGASLLRLFFHDCFVNGCDGSNLLDDTPTFTGEKNAAPNRNSLRGFDVVDQIKSAVEEVCPSIVSCADLLAIISRDAVEILGGPGWDVKLGRRDARTAANVSIPPPTNNLSALISGFQNHGXXGLSQQDLVALYGAHTVGQARCTNFRARIYXESNIDSSFAQEMKSNCPSVTGVGDNNLDGLDYQSATSFDNTYYVNLMRKRGLLHSDQQLFNGGSTDSLIRTYAQSQDTFFKDFAASMINMGDIKPLTGSNGEIRKNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_7_25755 (44364..46130)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGCCTTCTTCATTTTCAAAGGCCATTTTGACTTTGGCTTGCGTTGTGCTCCTCATCGGTGGCACNAGCGCTCAACTTTCGATTTTCTATTACACCGAAACTTGCCCCGACCTC
TTCCCGACGGTGAAGTCAATCGTGCAAGAAGCGATTGCGAAAGAGGCCCGCATGGGCGCCTCGCTCCTCCGCTTGTTCTTCCACGACTGCTTCGTCAAT
GTAACTTTTCTTCCCCCAATA
TTTATGACCAAAGTCATATATGTTTCTTAGAATTGGAAAAGCTGTTAATGCTCTTAGCTAAGAAAGAGTTTGGCTCCTTATCGCCTTTTCAATATTCATGGTTTATTTATCAGGGTTGCG
ACGGATCAAACCTCTTGGACGATACGCCTACTTTCACCGGAGAGAAGAACGCGGCCCCAAACCGAAATTCCTTGCGAGGGTTTGATGTGGTGGACCAGATTAAGTCCGCGGTGGAGGAAG
TGTGCCCCAGCATCGTCTCCTGCGCCGATTTGTTGGCGATTATCTCCCGAGATGCGGTTGAGATA
GTAGTCATTGGAGCTAGACTAGCAATGGAGACGAAAGCCTTTGATTATTTTTGAA
TGAGTAATAATTTTGTTGCGAATGAATTGGGCAGCTGGGAGGACCAGGGTGGGACGTGAAGCTAGGAAGGAGAGATGCGAGAACCGCAGCTAACGTTAGCATTCCTCCTCCAACTAATAA
CCTCAGCGCTCTCATTTCCGGCTTCCAAAATCATGGNNNNNATGGGCTTTCTCAACAAGACCTTGTCGCTCTATACG
GTGAATTTCCTCTCTCTTTCTCTCTTTCTCTCTCTCTCCACCA
TATGATATGTAGCATTTAATGATTTTTAGTAGGCGTGCTTTAGGGCATTCGTTAAGCAGTGTTCACTATCATACAAAATAATTTATTTGCAAAAGTCCAGGAAGATATCTGCTTCTTCTT
CTTTTTTACGAGCAAGTACTATACAAACTAAATCTCTTAGATCAAATCATTCACTTTTCAAGAATTTATGAGATCCACACTAAGCCCCACTAAAGAGCATGAGTTTTTGTGCAGTTTCTG
CATTTTAGTTGGATTTTTTATGAGTAAAACCTGCAGAGATTGTGTCTATTAGATCAAGTCCATCACACATAAAATTCTATAAGAGCCACAATGGGTCCCCNAAAAAAAAACCAAACTTTT
CATGCAACTACTACATTTTAATCAAGGTTGTCAAAAAAAAAATAAAATAAAAATTGGGGTTGTCCACCTTATCACTCACAAATTGAGTCTATATAGTATTCTTCATTTTATTACAATATT
CAAATTACTCAATTTAATACTTATTTATATGCCCTTCTACTCTTAAATACCCAGGAGCGCACACAGTTGGGCAAGCGAGATGCACAAACTTCCGGGCCAGGATCTACAANGAGAGCAACA
TCGACAGTTCATTTGCCCAGGAGATGAAGAGCAACTGCCCGAGCGTCACCGGCGTCGGCGACAACAACCTGGACGGGCTCGACTACCAGAGCGCGACATCGTTCGACAACACTTACTACG
TCAACCTCATGAGGAAAAGAGGCCTCCTCCACTCCGACCAACAGCTCTTCAATGGCGGGTCCACCGACTCGCTCATCAGGACTTACGCCCAAAGCCAAGACACCTTCTTCAAGGACTTTG
CGGCCTCCATGATCAATATGGGCGACATCAAGCCCCTCACCGGATCNAACGGCGAGATCAGGAAGAACTGTAGGAGGGTCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGCCTTCTTCATTTTCAAAGGCCATTTTGACTTTGGCTTGCGTTGTGCTCCTCATCGGTGGCACNAGCGCTCAACTTTCGATTTTCTATTACACCGAAACTTGCCCCGACCTC
TTCCCGACGGTGAAGTCAATCGTGCAAGAAGCGATTGCGAAAGAGGCCCGCATGGGCGCCTCGCTCCTCCGCTTGTTCTTCCACGACTGCTTCGTCAAT
GGTTGCGACGGATCAAACCTC
TTGGACGATACGCCTACTTTCACCGGAGAGAAGAACGCGGCCCCAAACCGAAATTCCTTGCGAGGGTTTGATGTGGTGGACCAGATTAAGTCCGCGGTGGAGGAAGTGTGCCCCAGCATC
GTCTCCTGCGCCGATTTGTTGGCGATTATCTCCCGAGATGCGGTTGAGATA
CTGGGAGGACCAGGGTGGGACGTGAAGCTAGGAAGGAGAGATGCGAGAACCGCAGCTAACGTTAGCATT
CCTCCTCCAACTAATAACCTCAGCGCTCTCATTTCCGGCTTCCAAAATCATGGNNNNNATGGGCTTTCTCAACAAGACCTTGTCGCTCTATACG
GAGCGCACACAGTTGGGCAAGCGAGA
TGCACAAACTTCCGGGCCAGGATCTACAANGAGAGCAACATCGACAGTTCATTTGCCCAGGAGATGAAGAGCAACTGCCCGAGCGTCACCGGCGTCGGCGACAACAACCTGGACGGGCTC
GACTACCAGAGCGCGACATCGTTCGACAACACTTACTACGTCAACCTCATGAGGAAAAGAGGCCTCCTCCACTCCGACCAACAGCTCTTCAATGGCGGGTCCACCGACTCGCTCATCAGG
ACTTACGCCCAAAGCCAAGACACCTTCTTCAAGGACTTTGCGGCCTCCATGATCAATATGGGCGACATCAAGCCCCTCACCGGATCNAACGGCGAGATCAGGAAGAACTGTAGGAGGGTC
AATTAG

Retrieve as FASTA