Entry information : EguPrx117
Entry ID 11428
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-13 (Christophe Dunand)
Peroxidase information: EguPrx117
Name EguPrx117
Class Class III peroxidase    [Orthogroup: Prx211]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx117
start..stop
S start..stop
EgrPrx117 652 0 1..326 1..326
EglPrx117 619 0 14..326 14..325
EcamPrx114 476 4e-171 8..326 5..322
EgrPrx114 473 1e-169 8..326 5..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48248..48478 231 N° 2 48854..49052 199 N° 3 49147..49305 159 N° 4 49403..49791 389
join(48248..48478,48854..49052,49147..49305,49403..49791)


exon

Literature and cross-references EguPrx117
Protein sequence: EguPrx117
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (296)
PWM (Da):   %s   35108.85 (32234.4) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.29 (6.88) Peptide Signal:   %s   cut: 31 range:31-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSTASSSFSKAVLSFACVLVLIGASTSAQLSLDYYSRSCPVLFPTVRLIVGAAIAREARMGASLLRLFFHDCFVNGCDGSLLLDDTPTFTGEKNAAPNVNSVRGFEVVDQVKSAVEGVCPGIVSCADLLAIIARDSVVIVSWPWWPVKLGRRDARSASQAXANESIPRPTSDLNELISSFRNVGLNIRDLVALAGGHTIGLSRCTNFRDRVYNETDIDVLLAQTRKFGCPGIDGVDDDNLAPLDFQSPITFDHSYYSNLVQRRGLLHSDQQLFNGGPADSFVRLYSRSPLAFQGDFVASITRMGDIKPLTGSNGEIRRNCRRV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_7_25755 (48248..49791)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCAACCGCTAGTTCTTCGTTTTCAAAGGCCGTTTTGAGTTTCGCTTGCGTTTTGGTCTTGATCGGTGCAAGCACGAGCGCNCAGCTTTCCCTCGACTATTATTCCAGATCT
TGCCCCGTCCTCTTCCCCACGGTGAGGCTGATCGTGGGAGCCGCTATAGCGAGGGAGGCTCGGATGGGCGCCTCACTGCTTCGCCTGTTCTTCCATGATTGCTTCGTCAAT
GTAACTTTC
ACCCTCCTCCAATCTTTTTTCACCTTCTGGAATCTTTCCACGCACATTCTTCTAACTCTGCACTCATCGCGCTCGTATGTGCAACCAGCATCATGCGATAGAGTTTATAACCAGTTCGCT
TGGGGTAATTCTTTTCATGATCCAATACTATGCAATGTGTTCACAGTTACTCAAATGGTTGTTCGTCGTTCAAAGTAGCAAGAGCTCAACATCTAGTCCATTGTCCCAAGGTCATAAGGA
ATTGAATATGAAAGCCTGAACTACTATTAATCTTAATGTAGCGCCTTTTAGCAAACATACTGCGAACCTAGAGCTGACGGAATACGTATTACTGTTGAAACGCATTTGATATCGGCGTTG
TATCAGGGCTGCGACGGATCGCTTCTTCTGGATGATACACCTACCTTCACTGGAGAGAAAAACGCCGCTCCAAATGTCAATTCAGTGCGAGGGTTCGAAGTGGTCGACCAAGTTAAGTCC
GCCGTGGAGGGGGTGTGTCCAGGCATTGTCTCGTGCGCCGATCTGTTGGCGATTATCGCGCGAGACTCCGTNGTGATCGTGAGCT
GTTTGAATTTGGCTAGCAATTAATATACAATTAAT
AGAGATTTGGCGATGTTCTAATTTAGTTCCCTTGGACTATCGTGCATGACAGCTTGGAGGGCCATGGTGGCCAGTGAAGCTGGGAAGAAGAGATGCTAGAAGCGCAAGCCAAGCAGNTGC
TAATGAGAGCATCCCCCGGCCGACGTCCGACCTCAACGAATTAATCTCCTCGTTCCGAAATGTCGGTCTCAACATCAGGGACCTCGTGGCTTTAGCAG
GTAACTAAAATTGGAATTTATC
TCGCATAATCGAATCAGAAAGATGAGATCGAGAGCTCGTTCAATTTGATACATATTTTTTTCGCGCCATTTCAAGGAGGCCACACGATCGGACTATCAAGATGCACGAACTTCAGGGACC
GGGTCTACAACGAGACCGACATCGACGTGCTGTTGGCCCAAACGAGGAAGTTCGGCTGCCCTGGCATCGACGGCGTGGACGACGACAATCTGGCCCCGCTCGACTTCCAGAGCCCGATAA
CGTTCGACCACAGCTACTACTCCAACCTCGTCCAGAGGCGCGGCCTTCTCCACTCGGACCAGCAGCTCTTCAACGGCGGGCCCGCCGACTCGTTCGTGAGGCTCTATAGCAGAAGCCCGC
TCGCCTTCCAGGGGGACTTCGTGGCCTCCATCACGAGGATGGGCGACATCAAGCCCCTCACCGGATCCAACGGTGAGATTCGGAGGAACTGCAGGAGGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCAACCGCTAGTTCTTCGTTTTCAAAGGCCGTTTTGAGTTTCGCTTGCGTTTTGGTCTTGATCGGTGCAAGCACGAGCGCNCAGCTTTCCCTCGACTATTATTCCAGATCT
TGCCCCGTCCTCTTCCCCACGGTGAGGCTGATCGTGGGAGCCGCTATAGCGAGGGAGGCTCGGATGGGCGCCTCACTGCTTCGCCTGTTCTTCCATGATTGCTTCGTCAAT
GGCTGCGAC
GGATCGCTTCTTCTGGATGATACACCTACCTTCACTGGAGAGAAAAACGCCGCTCCAAATGTCAATTCAGTGCGAGGGTTCGAAGTGGTCGACCAAGTTAAGTCCGCCGTGGAGGGGGTG
TGTCCAGGCATTGTCTCGTGCGCCGATCTGTTGGCGATTATCGCGCGAGACTCCGTNGTGATCGTGAGCT
GGCCATGGTGGCCAGTGAAGCTGGGAAGAAGAGATGCTAGAAGCGCAAGC
CAAGCAGNTGCTAATGAGAGCATCCCCCGGCCGACGTCCGACCTCAACGAATTAATCTCCTCGTTCCGAAATGTCGGTCTCAACATCAGGGACCTCGTGGCTTTAGCAG
GAGGCCACACG
ATCGGACTATCAAGATGCACGAACTTCAGGGACCGGGTCTACAACGAGACCGACATCGACGTGCTGTTGGCCCAAACGAGGAAGTTCGGCTGCCCTGGCATCGACGGCGTGGACGACGAC
AATCTGGCCCCGCTCGACTTCCAGAGCCCGATAACGTTCGACCACAGCTACTACTCCAACCTCGTCCAGAGGCGCGGCCTTCTCCACTCGGACCAGCAGCTCTTCAACGGCGGGCCCGCC
GACTCGTTCGTGAGGCTCTATAGCAGAAGCCCGCTCGCCTTCCAGGGGGACTTCGTGGCCTCCATCACGAGGATGGGCGACATCAAGCCCCTCACCGGATCCAACGGTGAGATTCGGAGG
AACTGCAGGAGGGTTAAT

Retrieve as FASTA