Entry information : EguPrx118
Entry ID 11429
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-13 (Christophe Dunand)
Peroxidase information: EguPrx118
Name EguPrx118
Class Class III peroxidase    [Orthogroup: Prx089]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx118
start..stop
S start..stop
EglPrx118 682 0 1..339 1..339
EgrPrx118 680 0 1..339 1..339
EcamPrx119 599 0 1..339 1..338
EgrPrx119 597 0 1..339 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7852..8097 246 N° 2 8583..9356 774  
join(7852..8097,8583..9356)


exon

Literature and cross-references EguPrx118
Protein sequence: EguPrx118
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (313)
PWM (Da):   %s   36248.59 (33557.2) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.22 (9.37) Peptide Signal:   %s   cut: 27 range:27-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADSMFWGIAWAFVLVLAGTVPSVAAATKPCRTSSKFRVGFYKYTCPVAESIVKQTLYEAIAKNPGMAAGLLRLHFXDCFVRGCDASVLLKSTPENPAXRDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGGIYYNVPAGPRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGISHCSSFSSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDPTVPLDSITPGTLDNKYYLQLLKLRGVLATDETLYTSPSTSRMVVSNAVNGAAWRAKFPKAMVKMGSLDVLTSAQGEIRELCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
scaffold_8_26562 (7852..9356)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCGATGTTCTGGGGTATCGCATGGGCTTTCGTTTTAGTTTTGGCCGGCACCGTCCCATCTGTGGCGGCGGCTACGAAGCCATGCCGGACATCGTCCAAGTTCAGGGTCGGA
TTCTACAAGTACACCTGTCCAGTTGCGGAGTCGATCGTCAAGCAGACTTTGTATGAAGCCATCGCCAAGAATCCGGGAATGGCGGCTGGACTCCTCCGCCTGCATTTCCNCGATTGCTTT
GTTAGG
GTACATGAAACATCTCTAGCTCCTTTTGACGAGTCCTTTAATTTATAAGCTCGTTTCACTATACGAATGCGCGTGCGTGGCCGTGCGCATACGTACTTCAAGACACATAATACT
TGGTCAATCCCTATCCATCAGAAATTACAATATTAGTCAACACCTCAGGGTTGACACAATTGCTTGGAGGGGAAGGTATTTTCATGTCGGCAACTGAAGATCGCCTATTCAAATCCCATA
ACTTACGTACTAACTGCACCGGGTCATCTGTATAGGCCAAAGATTGGACTTTAACAGGTTTGTTGGGGGTTGTAGGGTATTCCCCGGGCTTCAAAGGCAGCAAGGCCTCTAAACTCATGC
CCTTAGTTTATAAAATGAAATTTACATAATCAAACACAAAATTTAGTTAAGTAAATTTAACAGAGTTCGAAAAATAAAACGAATTTGGTATGGCATGTTGTTTCTATCTCTAACCATTGA
ATTTTGATTAGGGTTGCGATGCTTCGGTGCTCTTGAAATCGACCCCTGAAAACCCGGCGNAGAGAGACCATCCCACCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGACCAGGCCA
AGGCCAGACTCGAGGCCGTGTGTCCCAAAACGGTCTCGTGCGCCGACATCGTTGCTTTCGCGGCCCGCGACAGCGTCTACAAAACCGGGGGCATATATTACAACGTCCCTGCTGGCCCCC
GTGATGGCCGCGTCTCTCGCCTTTCCGAAGTGACCCAAAACCTCCCGTCGCCAAACTTCAACGCCCAACAGTTGATTGCTAATTTCGCCAGGAAAGGGCTGTCGGCGAACGAGATGGTGA
CCCTCTTGGGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCGTCCCGGCTCTACGCGTTCAATGCCACACTGACCCAAGATCCTTCGTTGGATCCGGCATTCGCCGCCTTCC
TGAAGACCAAATGCCTACCCCAAAGCAACGTGACACGAGTAGACCCGACGGTGCCGCTCGACAGCATCACACCTGGCACTCTGGACAACAAGTACTACCTTCAGCTGCTGAAGCTCCGCG
GCGTGTTGGCTACGGACGAGACACTGTACACAAGTCCCTCAACTTCGCGGATGGTTGTGAGCAACGCGGTGAATGGCGCCGCTTGGAGAGCGAAGTTCCCCAAGGCAATGGTGAAGATGG
GCTCGCTCGACGTGCTCACCAGCGCACAGGGAGAGATCAGGGAGCTGTGCAGTGTAGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCGATGTTCTGGGGTATCGCATGGGCTTTCGTTTTAGTTTTGGCCGGCACCGTCCCATCTGTGGCGGCGGCTACGAAGCCATGCCGGACATCGTCCAAGTTCAGGGTCGGA
TTCTACAAGTACACCTGTCCAGTTGCGGAGTCGATCGTCAAGCAGACTTTGTATGAAGCCATCGCCAAGAATCCGGGAATGGCGGCTGGACTCCTCCGCCTGCATTTCCNCGATTGCTTT
GTTAGG
GGTTGCGATGCTTCGGTGCTCTTGAAATCGACCCCTGAAAACCCGGCGNAGAGAGACCATCCCACCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGACCAGGCCAAGGCC
AGACTCGAGGCCGTGTGTCCCAAAACGGTCTCGTGCGCCGACATCGTTGCTTTCGCGGCCCGCGACAGCGTCTACAAAACCGGGGGCATATATTACAACGTCCCTGCTGGCCCCCGTGAT
GGCCGCGTCTCTCGCCTTTCCGAAGTGACCCAAAACCTCCCGTCGCCAAACTTCAACGCCCAACAGTTGATTGCTAATTTCGCCAGGAAAGGGCTGTCGGCGAACGAGATGGTGACCCTC
TTGGGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCGTCCCGGCTCTACGCGTTCAATGCCACACTGACCCAAGATCCTTCGTTGGATCCGGCATTCGCCGCCTTCCTGAAG
ACCAAATGCCTACCCCAAAGCAACGTGACACGAGTAGACCCGACGGTGCCGCTCGACAGCATCACACCTGGCACTCTGGACAACAAGTACTACCTTCAGCTGCTGAAGCTCCGCGGCGTG
TTGGCTACGGACGAGACACTGTACACAAGTCCCTCAACTTCGCGGATGGTTGTGAGCAACGCGGTGAATGGCGCCGCTTGGAGAGCGAAGTTCCCCAAGGCAATGGTGAAGATGGGCTCG
CTCGACGTGCTCACCAGCGCACAGGGAGAGATCAGGGAGCTGTGCAGTGTAGTGAACTGA

Retrieve as FASTA