Entry information : OsPrx133
Entry ID 1143
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx133
Name OsPrx133
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx133
start..stop
S start..stop
OsPrx132 671 0 1..334 1..334
BdiPrx118 514 0 13..334 10..331
SbPrx88 504 0 24..334 28..341
ZmPrx45 501 2e-180 26..334 33..345
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5623938..5624165 228 N° 2 5623635..5623820 186 N° 3 5623272..5623434 163 N° 4 5622728..5623155 428
complement(join(5622728..5623155,5623272..5623434,5623635..5623820,5623938..5624 165))


exon

Literature and cross-references OsPrx133
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1G0
DNA ref. GenBank:   NC_008404.1 (5624165..5622731)
Protein sequence: OsPrx133
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (305)
PWM (Da):   %s   34728.45 (32236.2) Transmb domain:   %s   i5-27o
PI (pH):   %s   5.16 (4.99) Peptide Signal:   %s   cut: 30 range:30-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRSGGGGGGPAMLLVAAVLVAGAAVSNAQLKVGFYSKSCPTAESTVASAVRQFADADSTILPALVRLQFHDCFAKGCDGSVLIKGVGNNAEVNNNKHQGLRGLDVVDSIKQQLESECPGVVSCADIVVLASRDAIAFTGGPSFDVPTGRRDGRTSSLRDADVLPDVKDSIDVLRSKFAANGLDDKDLVLLSSAHTVGTTACFFLQDRLYNFPLAGGGRGADPSIPEAFLSELQSRCAPGDFNTRLPLDRGSEAEFDTSILRNIRNGFAVIASDAALYNATATVGVVDTYSSMLSAFFGPYFRQDFADAMVKMGSVGVLTGAAGEVRKVCSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 11) and ESTs (mix with OsPrx132).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGGAGTGGTGGTGGCGGTGGTGGTCCGGCGATGTTGCTGGTGGCGGCGGTGCTCGTCGCCGGCGCCGCCGTCAGCAATGCGCAGCTGAAGGTGGGGTTCTACTCCAAGTCATGC
CCTACAGCTGAATCCACCGTCGCCTCCGCCGTCCGGCAGTTCGCCGACGCCGACAGCACCATCCTCCCCGCCCTTGTTCGTCTCCAGTTCCACGACTGCTTCGCCAAG
GTACATATACAT
AAAAATATTACAATAAATTATAATTTTTTCAATTGTGATATATATTTTGTTAGAATTTTAATTAAGTTTAATTAATTTTCTATTATAATATTTTTGGTTAATTAGGGGTGTGATGGGTCG
GTGCTGATCAAGGGAGTGGGGAATAACGCGGAGGTGAACAACAACAAGCACCAGGGGCTGCGTGGGCTTGACGTGGTGGACAGCATCAAGCAGCAGCTGGAGTCGGAGTGCCCCGGCGTC
GTCTCCTGCGCCGACATCGTCGTCCTCGCCTCCCGCGACGCCATCGCCTTC
GTACGTCCACCCACCGCGCCGGCGAAAACTCCTTTAAATTTTAATATTTATGAGTAAATTGATGATGAA
ATTTCTATAACAAGTACTTGTTATATTTGAATTTTGTTCGGGCTCAAAAAATCTTTCAGGCTCCGTCGCTGTGCACTGTACTGCCTAGCTCGGTGACATGGATTGATATGATCCGTTGTT
GTTGTTTGCAGACGGGTGGGCCGTCGTTCGACGTGCCGACGGGGCGGCGCGACGGGCGGACGTCGAGCCTCCGCGACGCCGACGTGCTCCCCGACGTCAAGGACTCCATCGACGTCCTCC
GCTCCAAGTTCGCCGCCAATGGCCTCGACGACAAGGACCTCGTCCTCCTCAGCT
GTAAGCCTCATCTTCTTCTTGACTCCTTGCATTGCCAACCATGGCGTCGAGGCGGTCGAGCACACT
AACCTAACCATGGCCGGCGACGGCGACGAACTCTTGTTTTTTGTTTGCAGCGGCGCACACGGTGGGGACGACGGCGTGCTTCTTCCTGCAGGACAGGCTGTACAACTTCCCGCTCGCCGG
CGGCGGCCGCGGCGCGGACCCGTCGATCCCGGAGGCGTTCCTCTCGGAGCTCCAGTCCCGGTGCGCCCCCGGCGACTTCAACACGCGGCTGCCGCTCGACCGCGGCAGCGAGGCCGAGTT
CGACACCTCCATCCTCCGCAACATCCGCAACGGCTTCGCCGTCATCGCCTCCGACGCCGCGCTCTACAACGCCACGGCCACCGTCGGCGTCGTCGACACCTACTCCAGCATGCTCAGCGC
CTTCTTCGGCCCCTACTTCCGCCAGGACTTCGCCGACGCCATGGTCAAGATGGGGAGCGTCGGCGTGCTCACCGGCGCCGCCGGCGAGGTCAGGAAAGTCTGCTCCAAGTTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGGAGTGGTGGTGGCGGTGGTGGTCCGGCGATGTTGCTGGTGGCGGCGGTGCTCGTCGCCGGCGCCGCCGTCAGCAATGCGCAGCTGAAGGTGGGGTTCTACTCCAAGTCATGC
CCTACAGCTGAATCCACCGTCGCCTCCGCCGTCCGGCAGTTCGCCGACGCCGACAGCACCATCCTCCCCGCCCTTGTTCGTCTCCAGTTCCACGACTGCTTCGCCAAG
GGGTGTGATGGG
TCGGTGCTGATCAAGGGAGTGGGGAATAACGCGGAGGTGAACAACAACAAGCACCAGGGGCTGCGTGGGCTTGACGTGGTGGACAGCATCAAGCAGCAGCTGGAGTCGGAGTGCCCCGGC
GTCGTCTCCTGCGCCGACATCGTCGTCCTCGCCTCCCGCGACGCCATCGCCTTC
ACGGGTGGGCCGTCGTTCGACGTGCCGACGGGGCGGCGCGACGGGCGGACGTCGAGCCTCCGCGAC
GCCGACGTGCTCCCCGACGTCAAGGACTCCATCGACGTCCTCCGCTCCAAGTTCGCCGCCAATGGCCTCGACGACAAGGACCTCGTCCTCCTCAGCT
CGGCGCACACGGTGGGGACGACG
GCGTGCTTCTTCCTGCAGGACAGGCTGTACAACTTCCCGCTCGCCGGCGGCGGCCGCGGCGCGGACCCGTCGATCCCGGAGGCGTTCCTCTCGGAGCTCCAGTCCCGGTGCGCCCCCGGC
GACTTCAACACGCGGCTGCCGCTCGACCGCGGCAGCGAGGCCGAGTTCGACACCTCCATCCTCCGCAACATCCGCAACGGCTTCGCCGTCATCGCCTCCGACGCCGCGCTCTACAACGCC
ACGGCCACCGTCGGCGTCGTCGACACCTACTCCAGCATGCTCAGCGCCTTCTTCGGCCCCTACTTCCGCCAGGACTTCGCCGACGCCATGGTCAAGATGGGGAGCGTCGGCGTGCTCACC
GGCGCCGCCGGCGAGGTCAGGAAAGTCTGCTCCAAGTTCAACTGA

Retrieve as FASTA