Entry information : EguPrx119
Entry ID 11430
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-02-13 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-13 (Achraf Jemmat)
Peroxidase information: EguPrx119
Name EguPrx119
Class Class III peroxidase    [Orthogroup: Prx089]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx119
start..stop
S start..stop
EcamPrx119 685 0 1..338 1..338
EgrPrx119 677 0 1..338 1..338
EglPrx119 676 0 1..338 1..338
EglPrx118 612 0 1..338 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11974..12216 243 N° 2 12680..13453 774  
join(11974..12216,12680..13453)


exon

Literature and cross-references EguPrx119
Protein sequence: EguPrx119
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (312)
PWM (Da):   %s   36392.77 (33715.4)  
PI (pH):   %s   9.65 (9.65) Peptide Signal:   %s   cut: 27 range:27-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVASMFRGLAWAFVLVLVDSLASAAATKPCPTSSKFTVRFYKYTCPAAESIIKQTVYEAVARNPGMAAGLLRLHFHDCFVRGCDASVLLKSTPKNPAERDHPANNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSIFKTGGIYYDVPAGRRDGRISRLSEVTQNLPPPNFNAQQLISNFARKGLSADEMVTLSGAHSIGISHCSSFSSRLYAFNTTLAQDPTLDPAFASLLKTKCPPPSNATRADPTVLLDSITPNALDNKYYLQLLKLRGVLATDETLYKSPSTSRMVVSNAVNGAAWRVKFAKAMVKMGSLDVLTGTQGEIRKVCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
scaffold_8_26562 (11974..13453)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCTTCGATGTTCCGGGGTCTCGCATGGGCTTTTGTCCTAGTTCTAGTCGACAGCCTCGCGTCTGCGGCGGCTACGAAGCCGTGCCCGACATCATCCAAGTTCACGGTCAGGTTC
TACAAGTACACCTGTCCGGCTGCGGAGTCTATCATCAAGCAGACTGTGTATGAAGCCGTCGCCAGAAATCCGGGAATGGCGGCCGGACTCCTCCGCCTACATTTCCACGATTGCTTTGTT
AGG
GTACGTGAAACATCTTTAGCTCCTTGTGACAAGTCCTTTAGTTTATAAGCTCGTTTCACTATACATATACGTGTGCATGGCCGTCCGCAAACGGACTTCATGACACATAATACTTTG
TCAATCACTATCCATTGAAAGTTACAAAATTGGTCAACGCTTCACGGTTGACACGATTGAAGGGAGCGTAAGTGTATTTTCATGTTAAAAGTTACGTACCAACTGCACCGGATCGGGTCA
TCTGTATAGGCTAAAAGTTGGACTTTAACAAGGTCATTGAGGTTGTAGGGTATTCCGTGCGCTTCAAAGATGGCAAGGCCTCTAAACTCATGCCCTTAGATTATAAAATGAAAGTCACAT
AATCAAATACAAGACTTCGTTGAGTAAATTTTACCTGCAAAGTTATTAAAGTAAGACATTTGGTATGGCATATTGTTTCTCTTTCTAACCATTGAATTTTGATTAGGGTTGCGATGCGTC
GGTGCTCTTGAAATCGACTCCTAAAAACCCGGCGGAAAGAGACCATCCGGCCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGATCAGGCTAAGGCCCGACTCGAGGCTGTGTGTCC
CAAGACGGTCTCGTGTGCCGATATCGTCGCTTTTGCGGCCCGCGACAGCATTTTCAAAACCGGGGGCATATACTATGACGTCCCCGCCGGACGCCGTGACGGCCGCATCTCTCGCCTTTC
CGAAGTGACCCAAAACCTCCCGCCACCAAACTTCAACGCCCAACAGTTGATCTCTAATTTTGCTAGGAAAGGGCTGTCGGCGGATGAGATGGTGACCCTCTCGGGAGCGCACTCCATCGG
CATCTCGCACTGCTCGTCCTTCTCNTCCAGGCTCTACGCGTTCAACACCACGCTCGCCCAAGATCCTACGTTGGATCCGGCGTTTGCCTCCTTGTTGAAGACCAAATGCCCACCCCCGAG
CAACGCGACACGAGCAGACCCGACGGTGCTGCTCGACAGCATCACGCCCAACGCTCTGGACAACAAGTACTACCTCCAGCTGCTGAAGCTCCGCGGCGTGTTGGCTACGGATGAGACGCT
GTACAAGAGTCCCTCGACTTCCCGGATGGTCGTGAGCAACGCAGTGAACGGCGCTGCCTGGAGGGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGCTCGACGTGCTCACCGGCAC
ACAGGGAGAGATCAGGAAGGTGTGCAGCGTGGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCTTCGATGTTCCGGGGTCTCGCATGGGCTTTTGTCCTAGTTCTAGTCGACAGCCTCGCGTCTGCGGCGGCTACGAAGCCGTGCCCGACATCATCCAAGTTCACGGTCAGGTTC
TACAAGTACACCTGTCCGGCTGCGGAGTCTATCATCAAGCAGACTGTGTATGAAGCCGTCGCCAGAAATCCGGGAATGGCGGCCGGACTCCTCCGCCTACATTTCCACGATTGCTTTGTT
AGG
GGTTGCGATGCGTCGGTGCTCTTGAAATCGACTCCTAAAAACCCGGCGGAAAGAGACCATCCGGCCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGATCAGGCTAAGGCCCGA
CTCGAGGCTGTGTGTCCCAAGACGGTCTCGTGTGCCGATATCGTCGCTTTTGCGGCCCGCGACAGCATTTTCAAAACCGGGGGCATATACTATGACGTCCCCGCCGGACGCCGTGACGGC
CGCATCTCTCGCCTTTCCGAAGTGACCCAAAACCTCCCGCCACCAAACTTCAACGCCCAACAGTTGATCTCTAATTTTGCTAGGAAAGGGCTGTCGGCGGATGAGATGGTGACCCTCTCG
GGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCNTCCAGGCTCTACGCGTTCAACACCACGCTCGCCCAAGATCCTACGTTGGATCCGGCGTTTGCCTCCTTGTTGAAGACC
AAATGCCCACCCCCGAGCAACGCGACACGAGCAGACCCGACGGTGCTGCTCGACAGCATCACGCCCAACGCTCTGGACAACAAGTACTACCTCCAGCTGCTGAAGCTCCGCGGCGTGTTG
GCTACGGATGAGACGCTGTACAAGAGTCCCTCGACTTCCCGGATGGTCGTGAGCAACGCAGTGAACGGCGCTGCCTGGAGGGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGCTC
GACGTGCTCACCGGCACACAGGGAGAGATCAGGAAGGTGTGCAGCGTGGTGAACTGA

Retrieve as FASTA