Entry information : EguPrx12
Entry ID 11431
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2014-01-16 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-15 (Christophe Dunand)
Peroxidase information: EguPrx12
Name EguPrx12
Class Class III peroxidase    [Orthogroup: Prx058]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx12
start..stop
S start..stop
EgrPrx12 689 0 1..334 1..334
EgrPrx05 681 0 1..334 1..334
EcamPrx12 677 0 5..334 1..330
EglPrx12 641 0 1..334 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8061..8306 246 N° 2 8475..8660 186 N° 3 8821..8980 160 N° 4 9257..9666 410
join(8061..8306,8475..8660,8821..8980,9257..9666)


exon

Literature and cross-references EguPrx12
Protein sequence: EguPrx12
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334
PWM (Da):   %s   36794.56  
PI (pH):   %s   7.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSSMWWQLLLSMLALVSSCAARRIQAEATIELPPPLQWQFYQNSCPDAEKYVRDQVEFYWKQDRTLAPKLIRIVYSDCFVKGCDASVLLDGPDSEKKAPQNAAFLGFTLEVIDKIKEVLEQHCPGVVSCADIINLAARDAVVLAGGTSYPVPTGRRDGNSSTAKSVDLPLQAVSWGSVVPYFQEKGLDVQDLTTLLGGHSLGKTGCQFVADRLYNFNKTGKPDPSVDPXFLSQLREQCPPNSTNQVYLNPDSGSSYSLGKTFYSRVLNHRAVLGIDQQIAANNDSYQIAQRYDASFEDFKKMFGRSMTRLGLVKLLPGDQGEVRKNCRVVNA

Retrieve as FASTA  
Remarks Complete sequence from genomic. containing motif ysdc
scaffold_1_267 (8061..9666)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATCNTCAATGTGGTGGCAGCTGTTGCTATCCATGCTCGCCTTGGTGAGCTCATGCGCGGCACGGCGCATCCAGGCAGAGGCGACGATCGAGCTGCCGCCACCATTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GTCCGTACTGTCTGTTTCTTTTTCCCCCGCTCTCGAACGATCTTGAAGTTTGCATTGCTTCGATATCGAGTTTCCATTGCCTTTCTAAGCACGTGATATCCTTTCACCTAACGT
TTAAACCTCTCGAACCGGGCTTTCTAATGTACCACGCTTTTGTGTATGAAACAGGGGTGCGATGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAAAAGCACCGCAAAATGCAGCG
TTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTGGAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCTGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GTATGCAACATGATTCGCAGTTTTTCCTTTTTGAGCTTGAAAAGGGATCGTTTGGTCTGCACTGCTGATAATCACTATGCTGTTAGCTTGAGTTTTTGGAGCGTTNGATATGGCAAAAGA
NAAAAACAGAATTACTGATGCGATAATGATGTTGTAATAGGCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAATTCATCCACTGCAAAGTCAGTGGACTTACCGTT
GCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTG
GTACGATCCGAACCTCCCATGAAAACTGCTTATTTGGCTC
CGTTACATTACCTTTAGATCGTAACCAATCCAGGCGAATCGTTCAGTTCAATGAATCATGACGTCCCTTTTCGCTTTCGAGTTTTCTAAATCACTGCCTAGGTGTCATGATACAAAGAAT
TCTTCTGACAGTGATCTCCTCCAAGCGCACAAAATGGCATTGCTCACGTATTATGTTAATCTCTCGATCATAACCAATTCCTCCTAACTTTGCCAAAACAATTTAAATTTTGACAGGGGG
GCATTCACTGGGCAAGACCGGCTGCCAATTCGTCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCANCCTTTTTGTCCCAATTGAGGGAGCAATG
CCCACCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAGCTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTAGGCATCGACCAGCA
GATTGCCGCCAACAACGACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCGAGGACTTCAAGAAGATGTTCGGCCGGTCAATGACCCGGCTGGGGCTCGTCAAGCTCCTTCCGGG
GGATCAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAATGCGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATCNTCAATGTGGTGGCAGCTGTTGCTATCCATGCTCGCCTTGGTGAGCTCATGCGCGGCACGGCGCATCCAGGCAGAGGCGACGATCGAGCTGCCGCCACCATTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GGGTGCGATGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAAAAGCACCGCAAAATGCAGCGTTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTG
GAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCTGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAAT
TCATCCACTGCAAAGTCAGTGGACTTACCGTTGCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTG
GGGGGCAT
TCACTGGGCAAGACCGGCTGCCAATTCGTCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCANCCTTTTTGTCCCAATTGAGGGAGCAATGCCCA
CCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAGCTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTAGGCATCGACCAGCAGATT
GCCGCCAACAACGACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCGAGGACTTCAAGAAGATGTTCGGCCGGTCAATGACCCGGCTGGGGCTCGTCAAGCTCCTTCCGGGGGAT
CAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAATGCGAAA

Retrieve as FASTA