Entry information : EguPrx120
Entry ID 11432
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx120
Name EguPrx120
Class Class III peroxidase    [Orthogroup: Prx182]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx120
start..stop
S start..stop
EcamPrx120 658 0 1..335 1..335
EglPrx120 643 0 1..335 1..335
EgrPrx120 643 0 1..335 1..335
EcamPrx119 438 2e-155 5..335 7..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16996..17235 240 N° 2 18472..19236 765  
join(16996..17235,18472..19236)


exon

Literature and cross-references EguPrx120
Protein sequence: EguPrx120
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (314)
PWM (Da):   %s   34987.67 (32862.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.83 (8.83) Peptide Signal:   %s   cut: 22 range:22-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASIQALVASFFLVFAVSATALPTQVYPLSSPSSLSVGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTAEKDSPVNNPSLEGFDVIDQAKAXLEAACPXTVSCADIIAFAARDXVFKAGRIYYDVPSGRRDGRISRASEVIQNLPPPTFTVPQLXANFARKGFSMDEMVTLSGAHSIGXSHCSSFSNRLYSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPXVALDSITPNTLDNKYYQQLLTYRGLFSSDEALYTSKLTKGMVLNNAKYGRVWGXKFVKAMVKLGSLXVXTGQQGXIRKVCXAXN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1). Scaffold_8_26562 (16996..19236)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTCAAGCCCTGGTCGCTTCCTTCTTCCTAGTTTTTGCTGTATCTGCAACAGCTCTCCCTACGCAGGTGTACCCGTTATCTTCGCCGTCGTCCCTCAGCGTCGGATTCTAC
AAATATACATGCCCTCCTGCCGAAGCCATCGTCAGAGCCACTCTTTATGAGGCCTTTTCCAGTGATCCGGGGTTGGCTGCTGATTTCCTCCGGATGTATTTCCACGACTGCTTCGTGAGG
GTAATATGCTCTATATGAACATCAAATGAAGGATTTTGCGCTTATTCATCATTCGTTTTCTTGATTTTCCAATAATGTGTTGATGCAGACTCAAATATCGGTTAAAATACGAAGTTGCCA
TGTTAACACCGACACCAAGATACTCTAGAAACGATATGGTGCCTTAAATGGGAAAATTATCAAAAAAAGTCTTAAACCTATTGTAATTGTGCCAATTNAGTCTTAATTTTTTTTTCNTTT
GCCAATTCAATCATAACGTGGACAATTTTAATAATATTTTAATTTTTTCGAATTTTTTAATAACTTTTTNTTTTTTCTTTTTCTTTTTCTTTTTCCTCTTCTTCCCCCTTTTCCTTTTTT
CCCCTATAGTGGCCGACGAGGCTCTGGNGATGGTCACGGCCCTNGCTCGGCCTTGCCTAGGTNTAGACAAGGTCTAGGGGCTATAGGCAAGGCGGCTTTGCCCAAATCTAGGCNAGACCA
ACCTNGCNATGTCCTTCCTAGCCACGGGTGAAGGTGGCCTTGCCCACATCTAGGTGAAGCTGCCTCACCCACAAGCCCCAGGCCCTGGGCTAGGCCGGGAGAGGGCTACGACTTTCACCG
GTGGCCGACAAGTGCTTCACAGCCCTCACCGGGAAAATGAAAAAAAGAGGAAAAATCAAAATCACAAAAAAAATAATAAAATAAAANATTATTCAAAATTGTCTACGTCAGCACCTATAA
GCCAAAATTGGATGGATGGACTTCATTGGCACGATTGCAAAATGTTTAGNATTGAATTGGCAAAAAAAAAACNAAAGATTTAAAACTAAATTNGCACAATTATAATAGATTTAATTTAAT
TTAATTTTTTTGTGATTCTCCCTACCCTAAACCTATCACAAGCATACAAGAAATGCATCAAAACATATGTATTTTTAGTGTTGTGTAGTGTAAAATTGCACCTTTCCCCGGTTGCTATTT
CTTACAGTGGAATGGATATAAAGAATGATTTCTCAATGCACATGCCGAGGCAGCAACTTATCACTAAGTTGTGCTTTGGCTGCATACCTTCCTTACTTTAGCAAAGCTAGGTTTACGAAG
ATCAGTATACAAAATTCGTATATTGTGCCAGAAAGTAGAAGGATTCCATAAGTGAAAATTGAAACAAGCGGGTAATAATCATATCTAATTTGAGTCTATCACATCATCTAGTATATCATA
TTATCTGATTTGTTAGCTCTTCCCCATTGATTTTAGGGCTGTGATGCATCCATCCTCCTAAATTCAACCAAGGGAAACACTGCCGAAAAAGATAGCCCCGTGAACAACCCTAGTTTAGAA
GGTTTCGATGTCATCGACCAAGCGAAAGCCCNGCTAGAAGCNGCATGCCCGCNAACTGTCTCGTGCGCCGACATCATCGCATTTGCGGCCCGAGACAGNGTCTTCAAGGCTGGCCGNATC
TACTACGATGTCCCCTCGGGCCGTCGTGATGGTCGCATCTCCCGCGCCTCCGAGGTGATCCAGAACCTCCCTCCCCCGACCTTCACNGTGCCGCAACTCANTGCCAACTTCGCGAGAAAA
GGNTTCTCAATGGACGAGATGGTGACCCTCTCGGGAGCACACTCCATCGGCANCTCTCACTGCTCGTCCTTCTCGAACCGTCTCTACTCGTTCAACGCGACGCACAAGCAAGACCCGTTG
TTGGACCCTAAGTACGCGGCCTTCTTGAAGACCAAGTGCCCCCAGGGCAATTCCAAGACGGACCCGANGGTGGCGCTCGACAGCATCACGCCNAACACTCTGGACAACAAGTACTACCAA
CAGCTACTGACTTACCGTGGGTTGTTCTCTTCCGATGAGGCGCTGTACACTAGCAAGTTGACGAAAGGGATGGTGTTGAACAACGCAAAATACGGCCGCGTGTGGGGGNCTAAGTTCGTG
AAGGCAATGGTGAAGCTGGGCTCGCTCNACGTGNTCACTGGTCAACAGGGCGANATTAGGAAAGTTTGCNGCGCCGNGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTCAAGCCCTGGTCGCTTCCTTCTTCCTAGTTTTTGCTGTATCTGCAACAGCTCTCCCTACGCAGGTGTACCCGTTATCTTCGCCGTCGTCCCTCAGCGTCGGATTCTAC
AAATATACATGCCCTCCTGCCGAAGCCATCGTCAGAGCCACTCTTTATGAGGCCTTTTCCAGTGATCCGGGGTTGGCTGCTGATTTCCTCCGGATGTATTTCCACGACTGCTTCGTGAGG
GGCTGTGATGCATCCATCCTCCTAAATTCAACCAAGGGAAACACTGCCGAAAAAGATAGCCCCGTGAACAACCCTAGTTTAGAAGGTTTCGATGTCATCGACCAAGCGAAAGCCCNGCTA
GAAGCNGCATGCCCGCNAACTGTCTCGTGCGCCGACATCATCGCATTTGCGGCCCGAGACAGNGTCTTCAAGGCTGGCCGNATCTACTACGATGTCCCCTCGGGCCGTCGTGATGGTCGC
ATCTCCCGCGCCTCCGAGGTGATCCAGAACCTCCCTCCCCCGACCTTCACNGTGCCGCAACTCANTGCCAACTTCGCGAGAAAAGGNTTCTCAATGGACGAGATGGTGACCCTCTCGGGA
GCACACTCCATCGGCANCTCTCACTGCTCGTCCTTCTCGAACCGTCTCTACTCGTTCAACGCGACGCACAAGCAAGACCCGTTGTTGGACCCTAAGTACGCGGCCTTCTTGAAGACCAAG
TGCCCCCAGGGCAATTCCAAGACGGACCCGANGGTGGCGCTCGACAGCATCACGCCNAACACTCTGGACAACAAGTACTACCAACAGCTACTGACTTACCGTGGGTTGTTCTCTTCCGAT
GAGGCGCTGTACACTAGCAAGTTGACGAAAGGGATGGTGTTGAACAACGCAAAATACGGCCGCGTGTGGGGGNCTAAGTTCGTGAAGGCAATGGTGAAGCTGGGCTCGCTCNACGTGNTC
ACTGGTCAACAGGGCGANATTAGGAAAGTTTGCNGCGCCGNGAAT

Retrieve as FASTA