Entry information : EguPrx121
Entry ID 11433
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-13 (Christophe Dunand)
Peroxidase information: EguPrx121
Name EguPrx121
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx121
start..stop
S start..stop
EgrPrx121 674 0 1..333 1..333
EglPrx121 646 0 1..333 1..333
EcamPrx121 645 0 1..333 1..333
EcamPrx122 546 0 1..333 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23635..23862 228 N° 2 22605..23402 798  
complement(join(22605..23402,23635..23862))


exon

Literature and cross-references EguPrx121
Protein sequence: EguPrx121
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (309)
PWM (Da):   %s   35468.18 (33059.9) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.64 (9.51) Peptide Signal:   %s   cut: 25 range:25-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASITAGFRALALVLFVSVFATAAQSPNSSLKVGYYRRTCPSTEAIVRKTVFEAVSRNPGMAAGLIRMXFHDCFVRGCDASVLLKSTXGNPAERDHPANNPSLRGFEIIDQAKAQLEALCPRTVSCADIVAFAARDSAYKARGIYYDVAAGRRDGRISRLXEVTQNLPPPSFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSFSSRLYTFNATLAQDPSLDPAYAAFLKXKCPPPSNVTQADPTVPLDSITANTLDNKYYLQLLKLRGLLTSDETLYTSPSTSRMVVNNAKNNFAWSVKFAKAMVKMGSIDVLTGKQGEIRKLCSIVNRPLYLFFA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
scaffold_8_26563 (23862..22605)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATCACAGCAGGATTTCGTGCGCTCGCGCTGGTTCTCTTCGTCTCAGTTTTTGCAACAGCAGCTCAAAGTCCGAACTCGTCCCTAAAGGTGGGATACTACCGACGTACTTGC
CCGTCGACAGAAGCTATTGTCAGGAAAACCGTGTTTGAGGCCGTCTCTAGGAACCCCGGGATGGCAGCTGGTCTCATTCGCATGCANTTTCATGATTGCTTCGTTAGG
GTACGGCGAAGT
ATTTATGCTCAGTAGTTTCGCCTTGATCAACTTATTTCTCCTTCCTTGAACTTTTCATTAATCCCCTTTTCTACCTAGTTGCGATTTAAGAGAAAGACAATGATGATAATGTGTGCTAAG
AGCATTTGCTAAGACTCATATAATNAATATTGGAAATGTAAGCTTTCTATTACGAGGCAAATGGNTTCTTTCAGTTACTAACTCATTCGCCTTATCTCAGGGCTGTGATGCTTCAGTGCT
CTTGAAATCAACCGNAGGAAACCCGGCGGAAAGAGATCACCCCGCGAACAACCCGAGCCTACGAGGGTTTGAAATCATCGATCAGGCCAAGGCCCAGCTCGAAGCCTTGTGCCCCAGGAC
CGTCTCATGTGCCGATATAGTTGCTTTTGCCGCCCGTGACAGTGCCTACAAGGCTAGGGGCATATACTACGATGTCGCTGCTGGCCGCCGCGACGGCCGCATCTCTCGCCTCNCGGAAGT
TACACAGAACCTCCCGCCGCCAAGCTTCAACGCCCAACAGCTCATTGCCAACTTCGCTAGGAAAGGGCTTTCGGCGGATGAGATGGTGACCCTGTCAGGAGCACACTCGATTGGAATCTC
CCACTGCTCTTCCTTCTCAAGCCGCCTTTACACGTTCAACGCCACACTCGCCCAAGATCCTTCCTTGGACCCTGCGTACGCTGCATTCTTGAAGAGNAAGTGCCCACCACCGAGCAATGT
GACGCAAGCAGACCCGACCGTGCCACTTGATAGCATCACAGCCAACACTTTGGACAACAAGTACTACCTCCAGTTGCTGAAGCTCCGTGGCTTGTTGACTTCTGACGAGACGCTGTACAC
GAGTCCCTCGACTTCAAGGATGGTCGTGAACAATGCGAAGAACAACTTCGCTTGGAGCGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGATCGACGTACTCACTGGTAAACAAGG
AGAGATCAGGAAGCTGTGCAGTATTGTAAATCGTCCTTTATATTTATTCTTTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATCACAGCAGGATTTCGTGCGCTCGCGCTGGTTCTCTTCGTCTCAGTTTTTGCAACAGCAGCTCAAAGTCCGAACTCGTCCCTAAAGGTGGGATACTACCGACGTACTTGC
CCGTCGACAGAAGCTATTGTCAGGAAAACCGTGTTTGAGGCCGTCTCTAGGAACCCCGGGATGGCAGCTGGTCTCATTCGCATGCANTTTCATGATTGCTTCGTTAGG
GGCTGTGATGCT
TCAGTGCTCTTGAAATCAACCGNAGGAAACCCGGCGGAAAGAGATCACCCCGCGAACAACCCGAGCCTACGAGGGTTTGAAATCATCGATCAGGCCAAGGCCCAGCTCGAAGCCTTGTGC
CCCAGGACCGTCTCATGTGCCGATATAGTTGCTTTTGCCGCCCGTGACAGTGCCTACAAGGCTAGGGGCATATACTACGATGTCGCTGCTGGCCGCCGCGACGGCCGCATCTCTCGCCTC
NCGGAAGTTACACAGAACCTCCCGCCGCCAAGCTTCAACGCCCAACAGCTCATTGCCAACTTCGCTAGGAAAGGGCTTTCGGCGGATGAGATGGTGACCCTGTCAGGAGCACACTCGATT
GGAATCTCCCACTGCTCTTCCTTCTCAAGCCGCCTTTACACGTTCAACGCCACACTCGCCCAAGATCCTTCCTTGGACCCTGCGTACGCTGCATTCTTGAAGAGNAAGTGCCCACCACCG
AGCAATGTGACGCAAGCAGACCCGACCGTGCCACTTGATAGCATCACAGCCAACACTTTGGACAACAAGTACTACCTCCAGTTGCTGAAGCTCCGTGGCTTGTTGACTTCTGACGAGACG
CTGTACACGAGTCCCTCGACTTCAAGGATGGTCGTGAACAATGCGAAGAACAACTTCGCTTGGAGCGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGATCGACGTACTCACTGGT
AAACAAGGAGAGATCAGGAAGCTGTGCAGTATTGTAAATCGTCCTTTATATTTATTCTTTGCTTGA

Retrieve as FASTA