Entry information : EguPrx123
Entry ID 11435
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx123
Name EguPrx123
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx123
start..stop
S start..stop
EglPrx123 664 0 1..328 2..329
EcamPrx123 663 0 1..328 2..329
EgrPrx123 658 0 1..328 2..329
CmicPrx01 469 3e-168 8..328 5..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24063..24287 225 N° 2 23065..23256 192 N° 3 22205..22370 166 N° 4 21450..21853 404
complement(join(21450..21853,22205..22370,23065..23256,24063..24287))


exon

Literature and cross-references EguPrx123
Protein sequence: EguPrx123
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (301)
PWM (Da):   %s   35699.37 (32834.9) Transmb domain:   %s   i9-31o
PI (pH):   %s   10.01 (10.12) Peptide Signal:   %s   cut: 28 range:28-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVMRSDRHSLILGCVLGFLVLLGGCHGGSLNKNFYRKSCPLAEEIVRNATWRHVAANIALPARFLRMHFHDCFVRGCDGSVLLNSTKNNTAEKEAIPNLTLAGFDVIDDIKAEVEKKCPGXVSCADILALAARDSVSFQFKKSMWXVLTGRRDGTVSLASEALANIPSPFLNFTALQQNFANKGLSVRDLVVLSGAHTIGVGHCNAFSVRLYNFTGKGDQDPSLNSTYAASLKNQCKNLTDNTTFVPMDPITPLSFDTRYFTVLRQRRGLFESDAALLTNPNSASITREMLNSRRFFKSFRTSIKRMGAISVLTGKSGEIRKVCSKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_8_26809 (24287..21450)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATGAGGAGTGATCGACACTCATTGATTTTAGGGTGTGTTTTAGGGTTCCTTGTGTTGTTAGGAGGCTGCCATGGGGGGAGCCTGAATAAGAACTTCTACAGGAAAAGCTGTCCC
TTGGCGGAGGAGATCGTGAGGAACGCGACNTGGAGGCATGTCGCGGCGAACATCGCACTGCCGGCGAGGTTCTTGAGGATGCATTTCCATGACTGCTTTGTTAGG
GTAAGCTTCCTTGTT
AATTACTCTTGACTCGTGTGATGACATAGATGCTTCGTTAGACTGCTCAGTTAGAGCAAGCGCAGTAAATGTAACAACATAACCTTGGTCGATATTCGCCAAGGACNCGGACGTCATGGT
AGACCAATAGAGTTGAATCATGTATATCACATATCATATAAGAGCATACCCTAGAGCGTCATTTAGGATTCATGTTCTAATAATCATTAGTACCCAAGGTTCACAATGCACTCATAACAA
TACTAAAATTAGTCTCTCTTCCTCTCGATAGTCTTAAATTTATAGATTAAAAATCATGTGAATTTGACATTGCGAGCCATGTGTAAATACCAACGAAAAAAAAAGCACTTCTTAGCAATG
TGACCTGCATTGTTAGTGAATTTTTCTCGCAAAACGAGGAGATGAGGCCAACATGCATTTGATCTCCACTAAATTGTAATTACCCTGTCGCGAAATCGAAATCACATATCCATTTAATTT
TATCAGTCCGTACATGAACGTGGGAATTAGAAAGTATACAAAACACCATCATTTATCGGACATGAGCCAAATAGTATTCTTTACGTAAAATTATCAACGCTACCTCTTTTAGCCCAACCC
ACTTGTAATGTCGCTCATAAGGTCAAGACTGGTTGCTCATTATCATTATTTAACCAAAGATCAGTAAATGAAAGCAGGTCGTCATGTACCTGTGTTGACCAATNTCTCATAAGTGCACAT
TAGATCTACGAGAATGAATCGAGAAAAGGCAAATGAACAATGGCAATTTCATGGTTCCATGNAATTTCCAGGGATGTGACGGCTCAGTCTTGCTGAACTCGACCAAGAATAATACGGCGG
AGAAGGAGGCAATCCCGAACCTCACGTTGGCGGGGTTTGATGTTATCGACGACATCAAAGCGGAGGTCGAGAAGAAGTGCCCGGGCNTTGTATCCTGCGCCGACATTTTGGCTCTGGCCG
CAAGGGACTCCGTTTCGTTCCAA
GTAAGTGCAAAAACATGTGAAGAAAGAAGCAAAGACAAATTCTTCTTTTCTAATCTAGAAGGATTTGTCAGAATTGACCATGCTAGGCATATATGAA
CACTTCTTTCTTCTTCTTTTTCAACACTTGGTATATATAATGAATATACATGAACATAGGCACATCGACATAAGGATCGATTTTACTGTTCANTCTGGGATTTGGATCCTCTCGAATAAT
NAACTCATAAGTGAGCCATCTCCAGTCTTTTACGTGATACCCTGACATAAGGCAAAGAAGAGATCCAATGGCCAAAAAACCTGCTTTCCCATCTTCTCTCTTTNTTTTCCCTGATTTCAC
ACCGAGCAACCCCCTACCACCACCATCCACCATGGCGTCGGCCCCACTCTGTTGCCTCCATGGCCCTCCACCTCCCTCCGTTTTCTCTGATTTTGTGCTCGATTTTTCATTAAAAAAGGG
GGCAATTTCGGTACTCCGAAAGCAAATAGACATGGCCGANTTATGGACTTAATTGACAGGAGCCTAATCATAGTACCGGACNTACATGCACCTGTCCGACAACGCCATGCAACGTCGAAA
ACTTACATCTTTCTTGATCACGAGAGAAGCCACTTAAGCATGTAAACTCCATATCACNAATATCTCCCGCCAAACTCATTAGACTTTTCTTCATTCTCTTCNTTCATACTTTTGCAGTTC
AAAAAGTCAATGTGGNAAGTGCTGACCGGAAGAAGAGACGGCACGGTGTCGCTAGCCTCCGAGGCCTTGGCCAACATCCCATCCCCTTTCCTCAACTTCACCGCCCTCCAACAGAATTTC
GCCAATAAAGGGCTAAGCGTGCGTGACCTTGTTGTTTTATCAG
GTACCGTAATTTCCTTACTAGCTCTCATGGGAAAAAGTTGCTCTCAAAAAAATTCCCGATCGAACCCGAAAGTTGGG
CTTTACACATGGATCACGATAGCTGTAAGCAAATAGTTGCATCGAATCAACAACCAGATCGTAGAACAAAGACACGATAACGAGAAAAGAGAGAACCTCTCGCATCGGAGCTCATCAATT
GACTCTGCCACTATGTTAGAAAGCCGCTAGCTTATGCCGAGAGCTTAAATTGCCCTCAAAAACAGGCTAATCACGTACATATTGAGCGTATTTGCGCGTTCTCTTAGTTTTTTGTTCTGG
ACGAATAATAATGCTTTTCGAGTGGTGTTTAAAGGTGCGCACACAATAGGAGTAGGGCACTGCAACGCCTTCAGCGTAAGGCTCTACAACTTCACCGGAAAAGGCGACCAAGACCCATCC
TTGAACTCCACCTACGCCGCCTCATTGAAGAACCAGTGCAAAAACCTTACCGACAACACCACCTTCGTGCCGATGGACCCAATCACCCCTCTCAGCTTCGACACTCGCTACTTCACCGTC
CTCAGACAGCGCAGGGGCCTCTTCGAATCCGACGCCGCGCTGCTCACGAACCCCAACTCGGCCAGTATCACTCGGGAGATGCTCAACTCGCGCAGGTTCTTCAAAAGTTTCAGGACGTCC
ATCAAGAGGATGGGGGCGATCTCCGTCCTCACAGGGAAATCTGGGGAGATTAGGAAGGTCTGTAGTAAGATCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATGAGGAGTGATCGACACTCATTGATTTTAGGGTGTGTTTTAGGGTTCCTTGTGTTGTTAGGAGGCTGCCATGGGGGGAGCCTGAATAAGAACTTCTACAGGAAAAGCTGTCCC
TTGGCGGAGGAGATCGTGAGGAACGCGACNTGGAGGCATGTCGCGGCGAACATCGCACTGCCGGCGAGGTTCTTGAGGATGCATTTCCATGACTGCTTTGTTAGG
GGATGTGACGGCTCA
GTCTTGCTGAACTCGACCAAGAATAATACGGCGGAGAAGGAGGCAATCCCGAACCTCACGTTGGCGGGGTTTGATGTTATCGACGACATCAAAGCGGAGGTCGAGAAGAAGTGCCCGGGC
NTTGTATCCTGCGCCGACATTTTGGCTCTGGCCGCAAGGGACTCCGTTTCGTTCCAA
TTCAAAAAGTCAATGTGGNAAGTGCTGACCGGAAGAAGAGACGGCACGGTGTCGCTAGCCTCC
GAGGCCTTGGCCAACATCCCATCCCCTTTCCTCAACTTCACCGCCCTCCAACAGAATTTCGCCAATAAAGGGCTAAGCGTGCGTGACCTTGTTGTTTTATCAG
GTGCGCACACAATAGGA
GTAGGGCACTGCAACGCCTTCAGCGTAAGGCTCTACAACTTCACCGGAAAAGGCGACCAAGACCCATCCTTGAACTCCACCTACGCCGCCTCATTGAAGAACCAGTGCAAAAACCTTACC
GACAACACCACCTTCGTGCCGATGGACCCAATCACCCCTCTCAGCTTCGACACTCGCTACTTCACCGTCCTCAGACAGCGCAGGGGCCTCTTCGAATCCGACGCCGCGCTGCTCACGAAC
CCCAACTCGGCCAGTATCACTCGGGAGATGCTCAACTCGCGCAGGTTCTTCAAAAGTTTCAGGACGTCCATCAAGAGGATGGGGGCGATCTCCGTCCTCACAGGGAAATCTGGGGAGATT
AGGAAGGTCTGTAGTAAGATCAACTAA

Retrieve as FASTA