Entry information : EguPrx124
Entry ID 11436
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx124
Name EguPrx124
Class Class III peroxidase     [Orthogroup: Prx022]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx124
start..stop
S start..stop
EgrPrx124 508 0 1..250 1..250
EglPrx124 509 0 1..250 31..280
EglPrx124 68 0.0000000000002 220..250 310..340
EcamPrx124 503 0 1..250 14..263
CclPrx59 413 3e-147 1..250 35..284
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47478..47600 123 N° 2 47854..48045 192 N° 3 48177..48342 166 N° 4 48435..48703 269
join(47478..47600,47854..48045,48177..48342,48435..48703)


exon

Literature and cross-references EguPrx124
Protein sequence: EguPrx124
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   26631.04  
PI (pH):   %s   4.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
YXDSCPNLTKLVRYGVWSAMANETRMAASILRLHFHDCLVNGCEGSVLLDDTSTXKGEKNAFANRNSARGFEVIDAIKANVEKACPAMVSCADILTLAAREAVYLTGGQFYAVPLGRRDGLSSSDSAANEQLPSPLEPLENITAKFTSKGLDMKDVVVLSGAHTIGFAQCFTFKTRLFNFGGSGXPDPALDTSFLQNLQVTCPNQDDSDTKLAALDTTSDKFDNYYYKNLINNSGLLQSDQALMGDNRT

Retrieve as FASTA  
Remarks Partial sequence from genomic (3 introns). Both 5' end and 3' end are missing. No EST. Scaffold_8_27590.(47478..48703)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACGANGACTCTTGTCCCAATCTGACGAAACTTGTTCGGTACGGCGTTTGGTCGGCTATGGCGAACGAGACCAGGATGGCTGCGTCTATCTTGCGCCTACATTTCCACGATTGTCTTGTC
AAT
GTAATTGAAACTCTTCGATTGCTTCTCCTGGGTGGTGTAAATTGGCANATCTGAAACTTTCTTTTTTTTGGTAACTTGGACTAAACTTTAAATTGGTCTGTGTGTGACAAACATCAT
AAGATCTAGACAGCTACATTTTTGGAAGCCTCGATTGATCGTGCTGAAAGATTAAAAAATGCTTTAAGCTATACCGTTACTGATGAACCAAATTGCAAACTCTCCTGTAAACATCTTTTN
TTTTTTGCATGGTCAGGGATGTGAGGGCTCGGTCCTGCTAGATGATACAAGCACAANAAAGGGAGAGAAGAATGCATTTGCCAATCGGAATTCAGCGAGAGGTTTCGAGGTCATTGATGC
CATCAAGGCGAATGTGGAAAAAGCATGCCCGGCCATGGTTTCTTGTGCTGATATTCTCACTCTAGCCGCAAGAGAAGCTGTATATTTG
GTAATCAACTCTGCTGTTGTGTATCCGCTCTT
CATGAGAACAGCTAGCTTCGCCTTTCGACCAGCTCATTCTGGCTCTGTGTCACTAAACGAACGTGCATTTGCACTTTCTTTTTTCTTTTATATCTTTAGACAGGAGGGCAATTTTATGCA
GTGCCCTTGGGGCGCCGAGACGGTTTAAGTTCGAGCGATAGCGCCGCCAACGAGCAGCTGCCTTCACCCTTGGAGCCCCTGGAAAACATCACTGCCAAGTTCACCTCTAAGGGTCTTGAC
ATGAAGGACGTGGTAGTGCTTTCAG
GTTCATATCTGTCTCTACAACTACCAACTAATATTATTTATCCTAGGTAAGATGATAAGACCAATTTGCGCTCTTTATTTCGGGATGCGCAGGTG
CGCATACAATAGGCTTTGCTCAATGCTTCACGTTCAAGACGAGGCTCTTCAACTTCGGCGGCTCCGGCNAGCCTGACCCNGCACTAGACACATCGTTTCTGCAAAATCTACAAGTGACGT
GCCCCAACCAGGACGACTCTGACACCAAGTTGGCTGCTTTAGACACAACATCTGATAAATTCGACAACTATTACTACAAGAACCTCATCAACAACTCCGGGTTGCTCCAGTCGGACCAAG
CCCTCATGGGCGACAACAGAACTGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACGANGACTCTTGTCCCAATCTGACGAAACTTGTTCGGTACGGCGTTTGGTCGGCTATGGCGAACGAGACCAGGATGGCTGCGTCTATCTTGCGCCTACATTTCCACGATTGTCTTGTC
AAT
GGATGTGAGGGCTCGGTCCTGCTAGATGATACAAGCACAANAAAGGGAGAGAAGAATGCATTTGCCAATCGGAATTCAGCGAGAGGTTTCGAGGTCATTGATGCCATCAAGGCGAAT
GTGGAAAAAGCATGCCCGGCCATGGTTTCTTGTGCTGATATTCTCACTCTAGCCGCAAGAGAAGCTGTATATTTG
ACAGGAGGGCAATTTTATGCAGTGCCCTTGGGGCGCCGAGACGGT
TTAAGTTCGAGCGATAGCGCCGCCAACGAGCAGCTGCCTTCACCCTTGGAGCCCCTGGAAAACATCACTGCCAAGTTCACCTCTAAGGGTCTTGACATGAAGGACGTGGTAGTGCTTTCA
G
GTGCGCATACAATAGGCTTTGCTCAATGCTTCACGTTCAAGACGAGGCTCTTCAACTTCGGCGGCTCCGGCNAGCCTGACCCNGCACTAGACACATCGTTTCTGCAAAATCTACAAGTG
ACGTGCCCCAACCAGGACGACTCTGACACCAAGTTGGCTGCTTTAGACACAACATCTGATAAATTCGACAACTATTACTACAAGAACCTCATCAACAACTCCGGGTTGCTCCAGTCGGAC
CAAGCCCTCATGGGCGACAACAGAACTGCC

Retrieve as FASTA