Entry information : EguPrx125
Entry ID 11437
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx125
Name EguPrx125
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx125
start..stop
S start..stop
EgrPrx125 659 0 1..326 1..326
EglPrx125 613 0 1..324 1..324
EgrPrx126 555 0 1..326 1..328
EglPrx126 552 0 1..326 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18059..18271 213 N° 2 17498..17689 192 N° 3 17228..17393 166 N° 4 16647..17053 407
complement(join(16647..17053,17228..17393,17498..17689,18059..18271))


exon

Literature and cross-references EguPrx125
Protein sequence: EguPrx125
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (304)
PWM (Da):   %s   34329.54 (31997.2)  
PI (pH):   %s   8.49 (8.21) Peptide Signal:   %s   cut: 23 range:23-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTARKVHLVLSLSLLLVVACNADGKLRXNFYKKSCPQAEKLVRDITWXKAQSDPTLGAKLLRMHYHDCFVQGCDGSILLDPVGTTQSEKNAVPNLALAGFDVIDDIKTQVEQACPNIVSCADVLSLAARDAVSFPFNKSMWNVLTGRRDGKVSLASNVAGKLPSPFANFSTLAQSFSETGLNVNDLVVLSGAHTIGVAHCGIISNRLYNFTGKGDADPSLXAAXAASLRTQCPNPANPAKTVDMDPQSSLSFDSHYFDILTENKGLFQSDXALLTNRGAAKVVQRLRSPAXFFAEFGKSMKKMGDIEVLTGTAGEIRKQCRVVNQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_8_29409 (18271..16647)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGCTAGGAAAGTTCATTTGGTTTTATCACTAAGTCTNCTCTTGGTTGTAGCGTGCAATGCAGATGGTAAATTGAGGNAGAACTTCTACAAGAAGAGTTGCCCTCAAGCTGAGAAG
CTTGTGAGGGACATCACTTGGANCAAGGCCCAATCTGACCCTACTCTGGGTGCTAAGCTTCTCAGGATGCACTATCACGATTGCTTTGTTCAG
GTAGCAAATTCCTATATATCCCCACCG
TAGCTTTTCCAATCAAAACANGCCGAGAGTAACCATTTTCTATGAGAAAAGTTGCCGGCTTTCTTTTTNTTACGGTGTGTCACTCGAGATTCCTGTCAACCTAATTAAAAGTTTAAGCCA
TCATTATGCCAATGATCATCTTCGCTTGTTGAGACAGAAGATGGGGAATGTAGGGAACATATTGTTCAACTTGTATTTCTCTAATTACTTTAAACTTTTAGACTTATAGGATATGAACAT
ATCTCAACCGTTCTAGATAAATCTTGTTTTACATCATAAGCATTCGGACTTAGCGAGCTCAACTCTCCATTTGATGAAATTGTGGAAATAATTATTTCNTAGGGATGCGATGGATCTATA
CTGCTGGACCCTGTGGGGACAACCCAATCTGAGAAGAACGCAGTACCAAATCTCGCCCTGGCTGGTTTTGATGTTATCGATGACATCAAGACACAAGTTGAGCAAGCTTGCCCTAACATC
GTCTCTTGCGCTGACGTTCTTTCTCTAGCCGCTCGCGATGCTGTTTCTTTCCCT
GTAAGATAAACTTGCCTGATCGATTGTCTAAAACCATAATTTTCATCATAAAAAATGGTCGAAATA
TAAGGTTTGTCATTTGAACACGATGGNGTGAATTGCAGTTTAACAAGTCGATGTGGAATGTGTTGACGGGAAGAAGAGACGGCAAGGTTTCATTAGCGTCCAATGTCGCTGGGAAGCTTC
CATCTCCTTTCGCAAACTTTAGTACTCTCGCACAAAGTTTCTCTGAGACAGGCCTTAATGTGAACGATCTTGTCGTTCTCTCTG
GTAAGCCAACATGATCATGTCTTTTTTCGGATGTTT
GAATTGATATTTCGTGACTTACATTTGGATCATCAAATTGGCATCGAAGCTAATTAAAGTACATAACTGACATACTACATCGAGTTAGACATTGCACAATGTATAATGAAGTCATCTATA
TCTTTGCTCCTTCATCAGGTGCGCATACCATTGGAGTTGCTCATTGCGGCATAATTTCCAATAGGCTCTACAACTTCACCGGGAAAGGAGATGCCGATCCCTCTCTGAANGCTGCCTANG
CTGCATCCCTCCGGACCCAGTGCCCTAACCCGGCCAACCCNGCTAAGACNGTGGACATGGATCCACAAAGCTCCCTCTCCTTCGATAGCCATTACTTCGATATTCTCACGGAAAACAAGG
GATTGTTCCAATCTGACNCTGCGCTCTTGACAAACCGAGGCGCAGCCAAGGTGGTCCAGCGCCTTCGGTCGCCNGCCNAGTTCTTTGCCGAGTTTGGCAAATCAATGAAGAAAATGGGGG
ACATCGAGGTACTGACGGGAACTGCCGGAGAGATTAGAAAACAATGTCGTGTGGTGAATCAATCN

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGCTAGGAAAGTTCATTTGGTTTTATCACTAAGTCTNCTCTTGGTTGTAGCGTGCAATGCAGATGGTAAATTGAGGNAGAACTTCTACAAGAAGAGTTGCCCTCAAGCTGAGAAG
CTTGTGAGGGACATCACTTGGANCAAGGCCCAATCTGACCCTACTCTGGGTGCTAAGCTTCTCAGGATGCACTATCACGATTGCTTTGTTCAG
GGATGCGATGGATCTATACTGCTGGAC
CCTGTGGGGACAACCCAATCTGAGAAGAACGCAGTACCAAATCTCGCCCTGGCTGGTTTTGATGTTATCGATGACATCAAGACACAAGTTGAGCAAGCTTGCCCTAACATCGTCTCTTGC
GCTGACGTTCTTTCTCTAGCCGCTCGCGATGCTGTTTCTTTCCCT
TTTAACAAGTCGATGTGGAATGTGTTGACGGGAAGAAGAGACGGCAAGGTTTCATTAGCGTCCAATGTCGCTGGG
AAGCTTCCATCTCCTTTCGCAAACTTTAGTACTCTCGCACAAAGTTTCTCTGAGACAGGCCTTAATGTGAACGATCTTGTCGTTCTCTCTG
GTGCGCATACCATTGGAGTTGCTCATTGC
GGCATAATTTCCAATAGGCTCTACAACTTCACCGGGAAAGGAGATGCCGATCCCTCTCTGAANGCTGCCTANGCTGCATCCCTCCGGACCCAGTGCCCTAACCCGGCCAACCCNGCTAAG
ACNGTGGACATGGATCCACAAAGCTCCCTCTCCTTCGATAGCCATTACTTCGATATTCTCACGGAAAACAAGGGATTGTTCCAATCTGACNCTGCGCTCTTGACAAACCGAGGCGCAGCC
AAGGTGGTCCAGCGCCTTCGGTCGCCNGCCNAGTTCTTTGCCGAGTTTGGCAAATCAATGAAGAAAATGGGGGACATCGAGGTACTGACGGGAACTGCCGGAGAGATTAGAAAACAATGT
CGTGTGGTGAATCAATCN

Retrieve as FASTA