Entry information : EguPrx126
Entry ID 11438
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-15 (Christophe Dunand)
Peroxidase information: EguPrx126
Name EguPrx126
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx126
start..stop
S start..stop
EgrPrx126 671 0 1..328 1..328
EglPrx126 668 0 1..328 1..328
EcamPrx126 578 0 47..328 1..282
EgrPrx125 560 0 1..328 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6334..6552 219 N° 2 5747..5938 192 N° 3 5478..5643 166 N° 4 4894..5303 410
complement(join(4894..5303,5478..5643,5747..5938,6334..6552))


exon

Literature and cross-references EguPrx126
Protein sequence: EguPrx126
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (306)
PWM (Da):   %s   34958.64 (32726.4)  
PI (pH):   %s   7.42 (7.06) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAGKGHLVLSLTLLLVLACNADDDGGXRKNFYKKSCPQAEKLVRDITWSKAQADPTLGAKLLRVHYHDCFVRGCDGSVLLDPVGTNQSEKNAVPNLTLAGFDVIDDIKKQVEQXCPNTVSCADVLSLAARDAVSFPFKKPMWDVLMGRRDGNISLASNIPGNLPSPFADFSXLAQIFSKKGLNVNDLVVLSGAHTIGVAHCGTFSRRLYNFTGKGDADPSLNATYAASLRTQCPNPANPATTVEMDPQSSLSFDSHYFDILIENEGLFQSDAALLTNQGAAKVVQHLRSPDAFFSEFGKSMKKMGAIEVLTGTAGEIRKQCRVVNQS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_8_29415 (6552..4894)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCTGGGAAAGGTCATTTGGTTTTGTCACTGACTCTTCTCTTGGTCCTAGCGTGTAATGCAGATGATGATGGTGGATTNAGGAAGAACTTCTACAAGAAGAGTTGCCCTCAAGCT
GAGAAGCTTGTGAGGGACATCACTTGGAGCAAGGCCCAAGCTGACCCTACTCTGGGTGCTAAGCTTCTCAGAGTGCACTATCACGACTGCTTTGTCCGG
GTAACAAATTCCTATATATCC
CCAAAGTAGATTCCCTGATCGAAACATGTGAAGAGTAACTACTATCTACAATAAAAGTTGCCGACCTTTCTTCTTTATAGTGTGTGACTTGAGATTCCTGTCAACCTATCTAAAAGTTTA
AGTCATTGTTATGCCAATAATCATCGTTGCTTGTTGAGACAGTAGGCAGGGAATATAGGGAACATATCTCAACCGTTCTGCATGGTTCATGCTTCACATCATATACGTTTGAACTTAGCG
AGCTCAACTCTCCATGTGATGAGTTAGGGCTTAAGACGTATGACTTTGCATTTGACATTATTAGAGAAATAGTTGCATCTAATGTCTCTCAATCACACCAAGGTTGACGAAATTCTGGAA
TAATTCATTTTTAGGGATGTGATGGATCCGTACTGCTGGATCCTGTGGGAACAAACCAGTCTGAGAAGAACGCAGTACCAAATCTCACTTTGGCTGGTTTTGATGTTATCGATGACATCA
AGAAACAAGTTGAGCAANCTTGCCCCAACACTGTCTCTTGTGCCGACGTTCTTTCGCTTGCCGCTCGTGATGCGGTCTCTTTCCCT
GTAAGAAAACCTGCCTAATTGATTGTCTAAAATC
ATTAATTTCTTCGCTGAAAATGGTCAAAATATAAGGTTTGTCATTTGAATATGATGGCGTAAATTGCAGTTTAAGAAGCCGATGTGGGATGTGTTGATGGGAAGAAGAGACGGCAACATT
TCGTTAGCATCCAACATCCCTGGGAACCTTCCATCTCCTTTCGCGGACTTTAGTANTCTTGCACAAATTTTCTCCAAGAAAGGCCTCAATGTGAACGATCTCGTTGTTCTCTCTG
GTAAG
CCGACGTGATCATGTCCTTTTTCGGATGGTTGAATTAAGATTTCCACACTTACATTTGGATCTTCAAATTAACATCGAAGCTAATTAAAGTACAAAACTGACATACTGCATTGAGTTAGA
CATTTCACAATGTACAATGAAATCATCTATATCTTTGCTCCTTCACCAGGTGCACATACCATTGGAGTTGCTCATTGCGGCACATTTTCCAGGAGGCTCTACAACTTCACGGGGAAAGGA
GACGCTGACCCTTCTCTGAACGCCACCTACGCTGCATCCCTCCGGACACAGTGCCCTAACCCGGCCAACCCGGCTACAACGGTGGAAATGGATCCGCAAAGCTCACTTTCCTTCGATAGC
CATTACTTCGATATTCTCATAGAAAACGAGGGATTGTTCCAATCCGATGCCGCTCTCTTGACAAACCAAGGTGCAGCCAAGGTAGTGCAGCACCTCCGGTCGCCAGACGCATTCTTCTCC
GAGTTTGGCAAGTCAATGAAGAAAATGGGGGCCATCGAGGTGCTCACGGGAACTGCNGGTGAGATTAGAAAACAATGTCGTGTGGTGAATCAATCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCTGGGAAAGGTCATTTGGTTTTGTCACTGACTCTTCTCTTGGTCCTAGCGTGTAATGCAGATGATGATGGTGGATTNAGGAAGAACTTCTACAAGAAGAGTTGCCCTCAAGCT
GAGAAGCTTGTGAGGGACATCACTTGGAGCAAGGCCCAAGCTGACCCTACTCTGGGTGCTAAGCTTCTCAGAGTGCACTATCACGACTGCTTTGTCCGG
GGATGTGATGGATCCGTACTG
CTGGATCCTGTGGGAACAAACCAGTCTGAGAAGAACGCAGTACCAAATCTCACTTTGGCTGGTTTTGATGTTATCGATGACATCAAGAAACAAGTTGAGCAANCTTGCCCCAACACTGTC
TCTTGTGCCGACGTTCTTTCGCTTGCCGCTCGTGATGCGGTCTCTTTCCCT
TTTAAGAAGCCGATGTGGGATGTGTTGATGGGAAGAAGAGACGGCAACATTTCGTTAGCATCCAACATC
CCTGGGAACCTTCCATCTCCTTTCGCGGACTTTAGTANTCTTGCACAAATTTTCTCCAAGAAAGGCCTCAATGTGAACGATCTCGTTGTTCTCTCTG
GTGCACATACCATTGGAGTTGCT
CATTGCGGCACATTTTCCAGGAGGCTCTACAACTTCACGGGGAAAGGAGACGCTGACCCTTCTCTGAACGCCACCTACGCTGCATCCCTCCGGACACAGTGCCCTAACCCGGCCAACCCG
GCTACAACGGTGGAAATGGATCCGCAAAGCTCACTTTCCTTCGATAGCCATTACTTCGATATTCTCATAGAAAACGAGGGATTGTTCCAATCCGATGCCGCTCTCTTGACAAACCAAGGT
GCAGCCAAGGTAGTGCAGCACCTCCGGTCGCCAGACGCATTCTTCTCCGAGTTTGGCAAGTCAATGAAGAAAATGGGGGCCATCGAGGTGCTCACGGGAACTGCNGGTGAGATTAGAAAA
CAATGTCGTGTGGTGAATCAATCGTAA

Retrieve as FASTA