Entry information : EguPrx129
Entry ID 11439
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx129
Name EguPrx129
Class Class III peroxidase    [Orthogroup: Prx076]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx129
start..stop
S start..stop
EcamPrx129-2 649 0 1..323 1..323
EcamPrx130 644 0 1..323 1..323
EgrPrx129 641 0 1..323 1..323
EglPrx130 640 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3341..3407 67 N° 2 3083..3225 143 N° 3 1479..2240 762  
complement(join(1479..2240,3083..3225,3341..3407))


exon

Literature and cross-references EguPrx129
Protein sequence: EguPrx129
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   33918.15 (31665.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.77 (8.89) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAYLSFVLVICLISPAISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRXHFHDCFVGCDGSILLNSTKGNTAEKDSMGNLGIGGFEVIDDAKAKIEARCPNTVSCADIVAFAARDGVRAAGGFHYAVPSGRRDGRVSLASEVIXNLPGAFFDXAQLXANFAKKGLSLRDMVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPRNGPTDPTVPXDPVTPNVLDNAYYHNLKSDKGLLYSDQVLWDXPLTRGLVKDNANHPSAWARRFTAAMVRMGSIEVLTXTQGEIRKNCRVIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1 and extra 5'). Scaffold_8_29664 (3407..1479).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCTGCAATTTCAGGTCCGATTTCATTTTCCCTTATGCTAGCAGTTTCAACACGTGCGTTTGAGTTG
ATATATTGTTCATTTTCTTGTCTTGGTCATAACCTTTTGTTTTCGGTTGGGTCCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCCATGGTGAG
AGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGNTCCATTTCCATGACTGTTTTGTCAGG
GTAATTTTCTAACTCAAGCATTTTATGTGCAACAT
CATTACANGTGTGTTTGGTTTAGCAATTGAAAAACTTGGGCAAATGCAAATACTGTTTGGCAAAATTTTTTGGGCACTTTGAGGAGATGCAATTTGCACCTTCAANNNNCTTTAAAGGCA
TTTAACGCAAATTAAGTTTGGAGATACTTTAAAATGTTATGTTTGCAAAATACAAATAGACATTTTTCCTTCCAACTTTACCCTCGCTCAACTTTCATAATTCCGAAAATGTTCTTGAAA
GCCCTAATTTTTGCCTCAGCCACCAACGAGCAACCGGCGTGCCATCGGTGAGTAGTTGGTGAGCCACTTCCACTCTCAATGGTGGTGACTGAGTTCCATCGACAAATAATTTGAGATTTT
TTATAAGAAAAATTAGCAAAAACCATTTACAAAGTATAATTTGTACCATACAATATTTCTATTAAAATTGCTTTTCAACGTGTTTTTAAAATACACTTTACCGAACAATACTTGTATTTT
GAAAAATCCTTTTAACCCAAATATCTTTGCATTTTTACAAAAAAACATTTCTAAAAAATCGAACTAAACACACCTTTTAAGTATTCTCTTGCAATGTCTATTATATTTGCATATTGATCC
ACTTGTTTCGCAAAACCCATACATGGGCCAGCTTTCATTTGAATAACTAATCCTAGGAACTTAGAAGTGGGGTTTGCATGATTGATGTCACAAGCTCTAAATGGATATCTAAATAAAGCT
GTCATAGATGTTCCTAGATCTAATTATAAATAATCATGTAAAAAATGGATATTTCTTTGGTGTGACGTACGGTCTTCTAGTACTCAGGGTTGCGACGGGTCCATTCTTCTCAACTCGACC
AAAGGGAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCGNTGCCCTAACACCGTCTCCTGTGCCGAC
ATTGTGGCCTTCGCCGCTCGCGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCNGAGGTGATCNAAAACCTCCCC
GGCGCATTTTTTGACNCTGCGCAACTCNAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTCCCAATTC
ACGAAGCGACTCTACTCCTTCAACTCGACGTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACGGCCCCACCGACCCGACCGTACCA
TTNGACCCCGTGACGCCGAACGTACTCGATAATGCTTACTACCACAACTTAAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATNCGCCATTGACAAGGGGGTTAGTG
AAGGACAATGCGAACCACCCGAGCGCTTGGGCTCGGAGGTTCACGGCAGCGATGGTNCGCATGGGTTCGATCGAGGTGCTCACTNGCACGCAAGGCGAAATTAGGAAGAATTGCAGGGTG
ATAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCTGCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCCATG
GTGAGAGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGNTCCATTTCCATGACTGTTTTGTCAGG
GGTTGCGACGGGTCCATTCTTCTCAACTCG
ACCAAAGGGAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCGNTGCCCTAACACCGTCTCCTGTGCC
GACATTGTGGCCTTCGCCGCTCGCGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCNGAGGTGATCNAAAACCTC
CCCGGCGCATTTTTTGACNCTGCGCAACTCNAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTCCCAA
TTCACGAAGCGACTCTACTCCTTCAACTCGACGTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACGGCCCCACCGACCCGACCGTA
CCATTNGACCCCGTGACGCCGAACGTACTCGATAATGCTTACTACCACAACTTAAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATNCGCCATTGACAAGGGGGTTA
GTGAAGGACAATGCGAACCACCCGAGCGCTTGGGCTCGGAGGTTCACGGCAGCGATGGTNCGCATGGGTTCGATCGAGGTGCTCACTNGCACGCAAGGCGAAATTAGGAAGAATTGCAGG
GTGATAAATTAA

Retrieve as FASTA