Entry information : EguPrx131
Entry ID 11442
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx131
Name EguPrx131
Class Class III peroxidase    [Orthogroup: Prx031]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx131
start..stop
S start..stop
EgrPrx131 660 0 1..327 1..327
EcamPrx131 660 0 1..327 13..339
EglPrx131 655 0 1..327 1..327
VvPrx19 492 5e-177 18..327 25..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6119..6340 222 N° 2 6443..6634 192 N° 3 6750..6915 166 N° 4 7187..7590 404
join(6119..6340,6443..6634,6750..6915,7187..7590)


exon

Literature and cross-references EguPrx131
Protein sequence: EguPrx131
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   34897.15  
PI (pH):   %s   4.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLELSAVALSKSPTTSREECADDHNASPLSTTFYEDTCPEAEAIIFSWVDRAVSEDPRMAASLLRLHFHDCFVNGCDASVLLDDIEGFVGEKTAGPNLNSLRGFEVVDAIKSELETVCPSTVSCADILASAARDSVLVSGGPGWDVLMGRRDSLGASRDAANNNIPAPNSTVEILVAKFQSAGLTLNDMVALSGAHTXGKARCPTFRSRLAGSAHSTGPKVNLEFLQSLQQLCSGPDSNSTLAELDLVTPATFDNQYYVNLVSGEGLLQSDQVLFAGDDRTRQIVESYAEDPLTFFEDFKRSMVRMGSLGPLTGKEGEIRRNCRIVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_8_29768 (6119..7590)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGAGCTGAGTGCCGTTGCCCTTTCGAAATCACCCACCACCTCGCGTGAAGAATGTGCAGACGATCACAATGCGAGCCCCTTGAGCACCACTTTCTATGAGGACACGTGCCCCGAA
GCGGAGGCGATCATCTTTTCTTGGGTCGATAGGGCGGTCTCCGAGGACCCGAGGATGGCCGCTTCGCTGCTGCGCCTTCATTTTCATGACTGTTTCGTCAAT
GCAAGTTTTGAAATCGAT
ATTGTCGTGGCATTTTCTCTTTCCAAATGTTCAAGTGAATAAGTTCAAGGTTCTCTTTTTTCTGTCAAATTATTTTTGGTGCAGGGATGCGATGCTTCTGTCCTTTTGGATGACATTGAA
GGTTTCGTGGGAGAGAAGACGGCCGGACCAAACTTGAATTCCTTGAGGGGGTTCGAAGTGGTCGACGCTATAAAATCTGAGCTTGAAACTGTTTGTCCTAGTACAGTTTCATGTGCCGAT
ATCCTTGCAAGCGCTGCCAGAGACTCTGTTTTAGTG
GTACGTTCTCAATCCGAATGGCACCTTAGGTACTCCGTAACTTATAAAATTTCTGAACTTGGAAGAGGGTTGTTAAGATATTAC
AGTCTAAGCTGATTCTTAGAATGAATCGCAGTCGGGCGGGCCTGGATGGGATGTTCTGATGGGTCGGAGAGACAGCTTAGGCGCGAGCAGAGACGCAGCGAACAACAACATTCCGGCGCC
AAATTCTACCGTGGAGATATTGGTTGCTAAGTTTCAGAGTGCTGGTCTCACCCTCAACGACATGGTCGCCCTATCTG
GTATCTTCTCCTGTTTATTATCCGATTCCCTAGTTTTGCACAT
CATGCCCTTCAAGCGCTTGAAAATTCACCTAGTGCAATGCCATTTTTAGAGGAAATAATTAGACTCGACGATGTAGAAACGTAGCGTCAACATGTTTTTTCCAGGTTACCATTAGGCGTA
CGTCGCAGCAACCTGGTATTTAATGTTTAGGAACTTGGGTGATGAGACCAAGTCTGCACATGCTAACAATACTGGAATTAGAAAGGATCGTTTGCTACTTTCACGCAGGTGCGCACACTN
TGGGAAAGGCTAGGTGCCCGACATTTAGATCACGGCTCGCGGGCAGTGCCCACTCGACCGGTCCAAAGGTCAACCTGGAGTTCCTTCAGTCACTGCAGCAGCTTTGCTCGGGTCCCGATA
GCAATTCGACTCTAGCAGAGCTCGACCTGGTGACGCCGGCGACTTTCGACAACCAGTACTATGTGAACCTTGTCTCAGGAGAGGGGCTGCTTCAGTCCGACCAGGTTCTCTTTGCCGGAG
ACGACAGAACGAGGCAAATAGTGGAGTCCTATGCAGAGGACCCCCTGACGTTCTTTGAGGATTTCAAGCGCTCGATGGTGAGAATGGGGAGCCTGGGGCCGCTCACGGGTAAAGAGGGCG
AAATCAGAAGAAATTGTAGAATCGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTGAGCTGAGTGCCGTTGCCCTTTCGAAATCACCCACCACCTCGCGTGAAGAATGTGCAGACGATCACAATGCGAGCCCCTTGAGCACCACTTTCTATGAGGACACGTGCCCCGAA
GCGGAGGCGATCATCTTTTCTTGGGTCGATAGGGCGGTCTCCGAGGACCCGAGGATGGCCGCTTCGCTGCTGCGCCTTCATTTTCATGACTGTTTCGTCAAT
GGATGCGATGCTTCTGTC
CTTTTGGATGACATTGAAGGTTTCGTGGGAGAGAAGACGGCCGGACCAAACTTGAATTCCTTGAGGGGGTTCGAAGTGGTCGACGCTATAAAATCTGAGCTTGAAACTGTTTGTCCTAGT
ACAGTTTCATGTGCCGATATCCTTGCAAGCGCTGCCAGAGACTCTGTTTTAGTG
TCGGGCGGGCCTGGATGGGATGTTCTGATGGGTCGGAGAGACAGCTTAGGCGCGAGCAGAGACGCA
GCGAACAACAACATTCCGGCGCCAAATTCTACCGTGGAGATATTGGTTGCTAAGTTTCAGAGTGCTGGTCTCACCCTCAACGACATGGTCGCCCTATCTG
GTGCGCACACTNTGGGAAAG
GCTAGGTGCCCGACATTTAGATCACGGCTCGCGGGCAGTGCCCACTCGACCGGTCCAAAGGTCAACCTGGAGTTCCTTCAGTCACTGCAGCAGCTTTGCTCGGGTCCCGATAGCAATTCG
ACTCTAGCAGAGCTCGACCTGGTGACGCCGGCGACTTTCGACAACCAGTACTATGTGAACCTTGTCTCAGGAGAGGGGCTGCTTCAGTCCGACCAGGTTCTCTTTGCCGGAGACGACAGA
ACGAGGCAAATAGTGGAGTCCTATGCAGAGGACCCCCTGACGTTCTTTGAGGATTTCAAGCGCTCGATGGTGAGAATGGGGAGCCTGGGGCCGCTCACGGGTAAAGAGGGCGAAATCAGA
AGAAATTGTAGAATCGTCAACTGA

Retrieve as FASTA