Entry information : EguPrx132
Entry ID 11443
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx132
Name EguPrx132
Class Class III peroxidase     [Orthogroup: Prx019]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx132
start..stop
S start..stop
EgrPrx132 627 0 1..315 15..329
EcamPrx132 623 0 1..315 19..333
EglPrx132 531 0 1..315 15..329
PvPrx17 516 0 9..315 29..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23224..23385 162 N° 2 22928..23119 192 N° 3 21741..22334 594  
complement(join(21741..22334,22928..23119,23224..23385))


exon

Literature and cross-references EguPrx132
Protein sequence: EguPrx132
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315
PWM (Da):   %s   34062.67  
PI (pH):   %s   4.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RQTAMAVALQPGYYAETCPGAEAAVREAMKVALIREPRSVASVMRFQFHDCFVNGCDGSLLLDDTPTMVGEKEAXSNINSLRSFEVXDEAKDALEKACPGIVSCADVVIMAARDAVALTGGPDWEVKLGRMDSLTACQEDSNDIMPSPRANASFLIDLFAGYGLSVKDLVALSGSHSIGQARCFSIMFRLYNQSGTGRPDPAIDPGFLDELXKLCPQGVDQNVTGNLDSTPRVFDNQYFKDLVAGRGFLNSDQTLFTFPQTRAYVRRFSLDQDEFFRAFLEGMIKMGDLMSDRPGEIRRNCRVVNSRPVDGLSES*

Retrieve as FASTA  
Remarks Partial sequence from genomic (Short 5' end is missing). No EST. Scaffold_8_30333 (23385..21741).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGGCAGACGGCCATGGCCGTGGCTCTCCAGCCCGGCTACTACGCCGAGACGTGCCCGGGAGCCGAGGCCGCGGTGAGGGAAGCGATGAAGGTGGCCCTGATCAGGGAGCCCCGGAGCGTC
GCCTCCGTCATGCGCTTCCAGTTCCACGACTGCTTCGTCAAT
GTAAACCGTCGAGCCGTGAATCTTTTCTGCTTCCGAATCATCTAATTTTCTTCTCCGTTGAATCTGAATGGTTTTCGT
TCTTTTGGTTTTTCTCTTCCCGAAAGGGCTGCGACGGGTCTCTGCTCCTGGACGACACGCCCACCATGGTCGGAGAGAAAGAGGCCNTGTCCAACATCAATTCGCTGCGGTCGTTCGAAG
TCATNGACGAGGCCAAGGACGCNCTGGAGAAGGCCTGCCCCGGCATCGTCTCCTGCGCCGACGTCGTCATCATGGCTGCTCGGGACGCAGTCGCCCTG
GTGAGTAAAATCTCTTCATCTT
TTTACCAACGAACAGAGCACGTCANNAAATTACACTAAACATCATTCCAAATTGAANTTACTTTGGAAAACCAGATTTATGTGGACACAAAGAAGAAGAGCTGTCCTTTTAATTACTGTA
GACAATGCAATGGCAATTTATGAAAATTTATAAAGTGAGANGAAAGGGAAATGACATTGGAGATATTGAATTATTTGTTCTTTTGATTCGATGAATATATTCTGAGATGGGGTCGGCGGT
TCATAAATAGGACATGCAAAAAGACAGTATTTTTTTTCCATAAATGGTGAAACTGCAGAATAATAGATATTTTGGAGCCTAGACGGTTTTGGCTGCCGGATTTGGCAAATGGTCCCTTCT
TCTAGTCCGGGTCCTGGTTCCTGAACAGGCTCGTGAGTGCGGGCCGCTCTGTTTCCGGCCCTGCGAATGNGAAAGACGATTGATTTCGCCCGATTTTAGTCCCTAAGGTAGGACCGGGGG
AAACAGGGGACATTTACAGCGCTGATCTTAGCCTAAGAACGGACGATCAACTTTGATTTGAGTTCTAATGCGACGGAGCTATCTTTTCTAGACCGGCGGGCCGGATTGGGAAGTGAAGCT
GGGGAGGATGGACAGCCTGACAGCCTGCCAGGAGGACTCGAACGACATAATGCCGAGCCCAAGGGCCAACGCGAGCTTCCTTATCGATCTCTTCGCCGGCTATGGCCTCTCCGTCAAGGA
CCTGGTGGCCCTCTCCGGGTCTCACTCCATCGGGCAGGCCCGGTGCTTCTCGATCATGTTCCGGCTCTACAACCAGTCAGGGACCGGCAGACCGGACCCCGCGATCGACCCAGGTTTCCT
GGACGAGCTCTNCAAGCTCTGCCCGCAGGGAGTCGATCAGAACGTGACGGGGAATCTGGACTCCACGCCCCGGGTGTTCGACAACCAGTACTTCAAGGACCTGGTCGCAGGNAGAGGGTT
CCTGAATTCGGACCAGACGTTGTTCACATTCCCGCAGACAAGGGCGTACGTGAGGAGGTTCAGCCTAGACCAGGACGAGTTCTTCAGGGCTTTCCTCGAGGGGATGATCAAGATGGGGGA
TCTGATGTCGGACCGGCCCGGCGAGATCAGGAGGAACTGTAGGGTGGTGAACAGCCGGCCGGTGGATGGCTTGTCGGAATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGGCAGACGGCCATGGCCGTGGCTCTCCAGCCCGGCTACTACGCCGAGACGTGCCCGGGAGCCGAGGCCGCGGTGAGGGAAGCGATGAAGGTGGCCCTGATCAGGGAGCCCCGGAGCGTC
GCCTCCGTCATGCGCTTCCAGTTCCACGACTGCTTCGTCAAT
GGCTGCGACGGGTCTCTGCTCCTGGACGACACGCCCACCATGGTCGGAGAGAAAGAGGCCNTGTCCAACATCAATTCG
CTGCGGTCGTTCGAAGTCATNGACGAGGCCAAGGACGCNCTGGAGAAGGCCTGCCCCGGCATCGTCTCCTGCGCCGACGTCGTCATCATGGCTGCTCGGGACGCAGTCGCCCTG
ACCGGC
GGGCCGGATTGGGAAGTGAAGCTGGGGAGGATGGACAGCCTGACAGCCTGCCAGGAGGACTCGAACGACATAATGCCGAGCCCAAGGGCCAACGCGAGCTTCCTTATCGATCTCTTCGCC
GGCTATGGCCTCTCCGTCAAGGACCTGGTGGCCCTCTCCGGGTCTCACTCCATCGGGCAGGCCCGGTGCTTCTCGATCATGTTCCGGCTCTACAACCAGTCAGGGACCGGCAGACCGGAC
CCCGCGATCGACCCAGGTTTCCTGGACGAGCTCTNCAAGCTCTGCCCGCAGGGAGTCGATCAGAACGTGACGGGGAATCTGGACTCCACGCCCCGGGTGTTCGACAACCAGTACTTCAAG
GACCTGGTCGCAGGNAGAGGGTTCCTGAATTCGGACCAGACGTTGTTCACATTCCCGCAGACAAGGGCGTACGTGAGGAGGTTCAGCCTAGACCAGGACGAGTTCTTCAGGGCTTTCCTC
GAGGGGATGATCAAGATGGGGGATCTGATGTCGGACCGGCCCGGCGAGATCAGGAGGAACTGTAGGGTGGTGAACAGCCGGCCGGTGGATGGCTTGTCGGAATCTTGA

Retrieve as FASTA