Entry information : EguPrx133
Entry ID 11444
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx133
Name EguPrx133
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx133
start..stop
S start..stop
EcamPrx133 667 0 1..327 1..327
EglPrx133 665 0 1..327 1..327
EgrPrx133 665 0 1..327 1..327
RcPrx53 503 0 11..327 3..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8980..9231 252 N° 2 9388..9576 189 N° 3 9679..9841 163 N° 4 10306..10685 380
join(8980..9231,9388..9576,9679..9841,10306..10685)


exon

Literature and cross-references EguPrx133
Protein sequence: EguPrx133
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   35112.13 Transmb domain:   %s   i12-34o
PI (pH):   %s   6.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARVKNRAAXDVMWGVMLLMQMMGLIRSFNFGIGGVDGLRMDYYFMSCPFAEQIVWNSVTSALQSDPTLAAGLLRMHFHDCFIQGCDGSVLLDSTKDNTAEKDSPANXSLRGYEVIDDAKEQIEEQCPGVVSCADILAMAARDAVFWAGGPRYEIPKGRKDGARSRIEDTINLPSPTFNASELIRMFGQHGFSAQEMVALSGGHTLGVARCSSFKQRLSNSDPTLXSXFAKTLSKTCSAGDNAEQPFDATRNTFDGAYYYGLVNKAGVLTSDQTLFASARTKGIVNGYAMNQAMFFFDFQQAMLKMSLLXVKEGSAGQVRLNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_9_30760 (8980..10685).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGGTGAAGAATAGAGCTGCGGNGGACGTGATGTGGGGGGTGATGTTGTTGATGCAGATGATGGGGTTGATCAGGTCGTTCAATTTCGGGATAGGAGGAGTCGACGGGCTGAGA
ATGGACTACTACTTCATGTCCTGCCCCTTCGCCGAGCAGATTGTCTGGAACTCCGTCACCTCCGCCCTCCAGTCCGACCCTACGCTTGCTGCCGGCCTCCTTCGCATGCATTTCCACGAC
TGCTTCATTCAG
GTATTCCACTCCAACCCTCGAGTTACCGCATGTATGCGTACACACACNTAGTTTAACTATACACAAANCGAGCTCATCACGTGGATCGATNTATGTAGGCAATGACTT
TCTGTGCTGCTTGTTGAGCCTGAACATGGACTTTATGCGCGTGTACAGGGATGCGATGGGTCGGTGTTGCTGGATTCGACCAAGGACAACACCGCAGAGAAAGACTCGCCCGCGAACNTA
AGCTTGAGAGGGTACGAAGTGATCGACGATGCGAAGGAGCAGATCGAAGAGCAATGCCCGGGCGTCGTCTCCTGCGCCGATATCTTGGCCATGGCCGCCAGAGATGCTGTGTTCTGG
GTA
ATATTTTCAGCCTACATCCGTCATGAGCGCAAGCCTCAGTCACCCCCCTCCTCTCACTCTCCTCTTTCAACTCCCCTGACGTAACCATATGAATTACAGGCGGGAGGTCCAAGATACGAA
ATACCGAAAGGGAGGAAGGACGGAGCGAGATCGAGGATAGAGGACACCATCAACCTGCCCTCTCCCACCTTCAACGCCTCCGAACTCATTCGCATGTTCGGNCAGCACGGNTTCTCCGCC
CAAGAGATGGTCGCTCTGTCNG
GTATTCGATCGCTTCTCTCTTTTTCTCAGCCCGAGTTATCCTATACCTAACATGCATCTATATTCAAGGAATATGTTTACATGGTCTAATGTAACAAG
AAACCTTCACATCAATCCAAATCAATCCTCGCATGCANAAAGCTATNCAATGAAAACATCACGCACTAAGTCGTAAATCATCTCTCGAGCATCCAATGCTATCTACAGGAGTGACCGACA
CTCTAGAACATAGATGGCATGACCCACAAAGACCAATTAAATGTATTAGTTAAGGGTCGATGAAAGGTNCAGACAAGCTAATTTGTCTTGTTTTAGGTCACGCAAATCTTTGATCTAGGA
TCGCCTTCCCTTTACATCAATAATTTATCAAAGGCACTGCTCCCATAAATCATGCAAAAACATGTACAAGCAAATCATGGAGNGGATCGTGTCTTTCGCTAATTTGTAATCAATTGAGTC
CGATAGGTGGACACACGTTGGGAGTGGCAAGGTGCTCGTCGTTCAAGCAAAGGCTGAGCAACTCCGACCCGACCCTCGANTCCNGCTTCGCCAAGACGCTGTCCAAGACGTGCAGCGCCG
GGGACAACGCAGAGCAGCCCTTCGACGCCACGCGGAACACCTTCGACGGCGCCTACTACTACGGCCTCGTCAACAAGGCGGGCGTGCTGACGTCGGACCAGACCCTGTTCGCCAGCGCCC
GGACCAAAGGGATTGTGAACGGNTACGCCATGAACCAGGCCATGTTCTTCTTCGACTTCCAGCAGGCCATGCTCAAGATGAGCCTGCTCGANGTCAAGGAAGGCTCCGCCGGCCAGGTCC
GTCTCAATTGTCGCAAGATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGGTGAAGAATAGAGCTGCGGNGGACGTGATGTGGGGGGTGATGTTGTTGATGCAGATGATGGGGTTGATCAGGTCGTTCAATTTCGGGATAGGAGGAGTCGACGGGCTGAGA
ATGGACTACTACTTCATGTCCTGCCCCTTCGCCGAGCAGATTGTCTGGAACTCCGTCACCTCCGCCCTCCAGTCCGACCCTACGCTTGCTGCCGGCCTCCTTCGCATGCATTTCCACGAC
TGCTTCATTCAG
GGATGCGATGGGTCGGTGTTGCTGGATTCGACCAAGGACAACACCGCAGAGAAAGACTCGCCCGCGAACNTAAGCTTGAGAGGGTACGAAGTGATCGACGATGCGAAG
GAGCAGATCGAAGAGCAATGCCCGGGCGTCGTCTCCTGCGCCGATATCTTGGCCATGGCCGCCAGAGATGCTGTGTTCTGG
GCGGGAGGTCCAAGATACGAAATACCGAAAGGGAGGAAG
GACGGAGCGAGATCGAGGATAGAGGACACCATCAACCTGCCCTCTCCCACCTTCAACGCCTCCGAACTCATTCGCATGTTCGGNCAGCACGGNTTCTCCGCCCAAGAGATGGTCGCTCTG
TCNG
GTGGACACACGTTGGGAGTGGCAAGGTGCTCGTCGTTCAAGCAAAGGCTGAGCAACTCCGACCCGACCCTCGANTCCNGCTTCGCCAAGACGCTGTCCAAGACGTGCAGCGCCGGG
GACAACGCAGAGCAGCCCTTCGACGCCACGCGGAACACCTTCGACGGCGCCTACTACTACGGCCTCGTCAACAAGGCGGGCGTGCTGACGTCGGACCAGACCCTGTTCGCCAGCGCCCGG
ACCAAAGGGATTGTGAACGGNTACGCCATGAACCAGGCCATGTTCTTCTTCGACTTCCAGCAGGCCATGCTCAAGATGAGCCTGCTCGANGTCAAGGAAGGCTCCGCCGGCCAGGTCCGT
CTCAATTGTCGCAAGATCAACTGA

Retrieve as FASTA