Entry information : EguPrx135
Entry ID 11446
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx135
Name EguPrx135
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx135
start..stop
S start..stop
EglPrx135 668 0 1..331 1..331
EgrPrx135 668 0 1..331 1..331
NtPrx36-1A 466 6e-167 14..331 9..327
PpePrx08 465 2e-166 31..331 32..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5864..6094 231 N° 2 5409..5600 192 N° 3 5135..5300 166 N° 4 4446..4852 407
complement(join(4446..4852,5135..5300,5409..5600,5864..6094))


exon

Literature and cross-references EguPrx135
Protein sequence: EguPrx135
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   35476.06 (33080.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.65 (6.12) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKHLLLFQITLISLILAVSCFPAHSPIGQLSPYYYXRSCPRLQWIVRSNVWAAFQKDTRIAASLLRLHFHDCIVDGCEGSVLLDDTVDMKGEKNALPNRNSLRGFEVIDAIKADLENXCPFTVSCTDILTLAAXEAVYXSGGPYWAVLLGRRDGITASDKSANEQIPSPIEPLDNIVAKFTSKGLELKDVVVLSGGHTIGFAQCFTFKRRLFNFKGSGKPDPTLDTSLLSSLQSTCPNKDASNTNLAPLDSTVDKFDNYYYANLVNNSGLLESDQALIADARAAPLVNSYTTNPTLFYNDFAASMLKLGNVGILTGQSGQIRKQCGSVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_9_32307 (6094..4446)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAAGCACCTTTTGCTATTCCAAATCACATTGATTAGCTTGATCTTAGCAGTCTCTTGCTTCCCTGCTCATAGCCCGATAGGCCAGCTCTCTCCGTATTATTATGANAGATCG
TGCCCTCGCTTGCAATGGATCGTCAGATCCAACGTTTGGGCAGCCTTCCAGAAAGATACAAGGATTGCTGCCTCTCTTCTTCGATTACACTTTCATGACTGCATCGTCGAT
GTAAGTAAT
TCTATCCAAGTGTCGTCATGATTGCAGCTTATTTGCGTGCACTTTTCCTCGANGATAATTTTAGGTTCNGTCGCTTCTTCTCGGTTTGGCGACTTAGCAGAGACATGTACAGCACGTTTT
ATTAGGAAAAGTCTTGACGGCATATGTTTCGCATTTGCATTGCTACCNAACATCGTGACATGGTTAAGCATGTGACCGGACTCGAGGCTTATGTTATCCCTAGACACTGAACAACACTAC
ACCATCGATGTTAGGGCTGCGAAGGATCCGTGCTTCTTGATGACACCGTAGACATGAAGGGCGAGAAGAACGCCTTGCCAAATCGCAACTCTCTCCGAGGCTTTGAAGTCATCGACGCTA
TAAAAGCCGACCTCGAGAATTNCTGCCCCTTCACCGTCTCGTGCACTGATATACTCACCCTAGCTGCAANAGAAGCCGTCTATANG
GTACCTTAATAAACCCCAGTTCTCTTCTTCACGA
ATACAATAGTTGAGCATGGCTCCTAAGCTAATAAGCACTTAATGAAAAACTAATTGGCCTTGATGGAGTTTTAGTCAGGTGGGCCTTATTGGGCCGTACTATTGGGAAGAAGAGATGGAA
TCACGGCTAGCGACAAGTCGGCCAATGAACAGATACCGTCGCCTATTGAGCCTTTGGATAACATCGTTGCTAAGTTCACTTCAAAGGGTCTGGAGTTGAAGGATGTTGTGGTCCTCTCAG
GTACTTAATTTTCTCTGCATGCAATAGTAGTGAACAAAAAGCAGACTTCTCCGAGCAATACCAAGGCCAGAAGAACAATAACCACAGAGAAATAAAGTCATATGAACTATTTTTGGTCTA
ACANAATATAGACAGAATTAATGATCACGATCACAATAAGAAAGACATGAAATCCATGTCTTTTTCATTGATACGAGATNACCAAGGTNCGCTTGGAAGCGCTGTATATGTAAAGGAAGC
GATTCTAATGAGTTGTCCTCATTTTTTCNAAATCACTTTTAGGAGGGCACACCATAGGCTTTGCCCAGTGTTTCACCTTCAAGAGGAGGCTCTTCAACTTCAAAGGGTCCGGCAAGCCTG
ACCCGACCTTGGACACCTCCCTCTTATCGAGCCTCCAGAGCACATGCCCCAATAAAGACGCCTCCAACACCAACCTCGCTCCTCTNGACTCCACTGTGGACAAATTCGACAACTACTACT
ACGCCAACCTGGTGAACAATTCGGGCCTACTCGAATCGGATCAAGCCTTGATCGCTGACGCGAGAGCCGCCCCACTCGTCAATTCCTACACCACCAACCCCACGCTGTTCTATAATGATT
TCGCCGCTTCCATGTTGAAGTTAGGCAATGTTGGAATTCTCACTGGGCAGAGTGGGCAGATTAGGAAGCAGTGTGGCTCCGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAAGCACCTTTTGCTATTCCAAATCACATTGATTAGCTTGATCTTAGCAGTCTCTTGCTTCCCTGCTCATAGCCCGATAGGCCAGCTCTCTCCGTATTATTATGANAGATCG
TGCCCTCGCTTGCAATGGATCGTCAGATCCAACGTTTGGGCAGCCTTCCAGAAAGATACAAGGATTGCTGCCTCTCTTCTTCGATTACACTTTCATGACTGCATCGTCGAT
GGCTGCGAA
GGATCCGTGCTTCTTGATGACACCGTAGACATGAAGGGCGAGAAGAACGCCTTGCCAAATCGCAACTCTCTCCGAGGCTTTGAAGTCATCGACGCTATAAAAGCCGACCTCGAGAATTNC
TGCCCCTTCACCGTCTCGTGCACTGATATACTCACCCTAGCTGCAANAGAAGCCGTCTATANG
TCAGGTGGGCCTTATTGGGCCGTACTATTGGGAAGAAGAGATGGAATCACGGCTAGC
GACAAGTCGGCCAATGAACAGATACCGTCGCCTATTGAGCCTTTGGATAACATCGTTGCTAAGTTCACTTCAAAGGGTCTGGAGTTGAAGGATGTTGTGGTCCTCTCAG
GAGGGCACACC
ATAGGCTTTGCCCAGTGTTTCACCTTCAAGAGGAGGCTCTTCAACTTCAAAGGGTCCGGCAAGCCTGACCCGACCTTGGACACCTCCCTCTTATCGAGCCTCCAGAGCACATGCCCCAAT
AAAGACGCCTCCAACACCAACCTCGCTCCTCTNGACTCCACTGTGGACAAATTCGACAACTACTACTACGCCAACCTGGTGAACAATTCGGGCCTACTCGAATCGGATCAAGCCTTGATC
GCTGACGCGAGAGCCGCCCCACTCGTCAATTCCTACACCACCAACCCCACGCTGTTCTATAATGATTTCGCCGCTTCCATGTTGAAGTTAGGCAATGTTGGAATTCTCACTGGGCAGAGT
GGGCAGATTAGGAAGCAGTGTGGCTCCGTGAACTAA

Retrieve as FASTA