Entry information : EguPrx137
Entry ID 11448
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx137
Name EguPrx137
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx137
start..stop
S start..stop
EgrPrx137 678 0 1..332 1..332
EglPrx137 678 0 1..332 5..336
EcamPrx137 666 0 1..332 1..331
CclPrx35 563 0 1..331 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..228 228 N° 2 544..735 192 N° 3 894..1059 166 N° 4 1155..1567 413
join(1..228,544..735,894..1059,1155..1567)


exon

Literature and cross-references EguPrx137
Protein sequence: EguPrx137
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (310)
PWM (Da):   %s   36373.77 (33883.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.55 (9.66) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQSKNFLIIFCVLALAPLGLCAKAGYGGYLYPQFYDHSCPKAQEIVKSVVAKAVAKDPRMGASLLRLHFHDCFVKGCDASLLLDSSGTIISEKRSVPNTNSARGFEVLDEIKFALEKECPQTVSCADLLALAARDSTVLTXGPSWVVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNARCTTFRQRLYNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQNLFFLDFVSPIKFDNSYFKNLLAKKGLLSSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMVKMGNITPLTGSKGQIRKRCRQVNK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_11_36238 (16460..18442)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCAATCCAAGAACTTCCTCATCATTTTCTGTGTTCTTGCTCTGGCTCCACTCGGTCTCTGTGCCAAGGCAGGTTATGGGGGTTACCTTTATCCACAATTCTACGACCATTCTTGC
CCCAAGGCTCAAGAGATAGTGAAGTCNGTGGTNGCCAAGGCCGTTGCGAAAGATCCTCGCATGGGCGCTTCACTCCTCCGCTTACATTTCCACGATTGCTTCGTTAAG
GTCAGCGGCTAC
GCAATTACTTGGAGTAAATAAGTTTCCACGTCTAATCTTTGGTTTCAAAAAGTTGCAAAAATAGTTTCTTATACATGTACTCTAAGTCAGCACTCCATGCGAAGAGTAAACAATCTCGTC
GATCATTTTTCCTGGTTTAGAAGCTTTCTCGATGCTTCCAGTGCATTAACTGCTCGTCATAGCACAACAAAGCATTTCTTATCGCCACTGTCAGGAGTAATTTGTACTTACATTTTGCTT
CCTATTAGAGCATGTTTATAATATGCTCTGTCTAAGTACCAACGTTGTCGATGTATGTGACAGGGCTGCGACGCATCCTTATTGCTGGACAGCAGCGGCACTATAATCAGTGAGAAGCGG
TCCGTCCCTAACACGAACTCAGCCAGAGGCTTTGAAGTGCTTGATGAGATCAAATTTGCACTGGAGAAGGAGTGCCCTCAAACAGTGTCTTGTGCTGACCTGTTGGCCTTGGCTGCCAGA
GACTCCACTGTTCTT
GTAAGCATATGTAGATACAGTAGTGCCCAACTTCTCTCAGAAAAAATTTCAACTTTTCACCCAAGAAAAAACCAGGAAAAAAGAAAAGCCAAAAAAAAAAAAAAA
AACTAATTTGAAATGCCTAACGAGCATAAATCAATGCTTGAATGTGTAAACAGACTNGTGGGCCTAGCTGGGTAGTGCCACTGGGAAGGAGGGACTCAACAGGAGCAAGCTTGAGTGGCT
CTAACAACAACATTCCTGCTCCAAACAACACTTTCCAGACCATTCTCACCAAGTTCAAGCTTAAAGGACTTGATATTGTTGATCTTGTTGCCCTCTCCG
GTAAAATAATTGGAATTTCTT
GACCTTAGTTTTGATTATAGCATTCGAGTCCAAGTTAGGGAAAATAAAATTGTTGGAAATGTCCCGTTACACAGGAAGCCACACAATTGGAAATGCAAGATGCACCACCTTCAGGCAGAG
GCTCTACAACCAGACAGGCAACGGGCAGCCCGACTTCACGCTCGACCAATCCTACGCNGCTCAGCTCCGCACCCGCTGCCCACGGTCCGGGGGCGACCAGAACCTCTTCTTCTTGGACTT
TGTCAGCCCGATAAAGTTCGACAACAGCTACTTCAAGAACCTGTTGGCTAAGAAGGGGCTCTTGAGCTCCGACGAAGTCCTCGTGACGCAGAGCCAGGCCACGCTGCAGCTGGTGAAGCA
GTATGCGGGGAACCAAGAGCTCTTCTTCGAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCACCCCACTGACAGGGTCCAAGGGACAGATCAGGAAGCGTTGTAGGCAGGTCAA
TAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCAATCCAAGAACTTCCTCATCATTTTCTGTGTTCTTGCTCTGGCTCCACTCGGTCTCTGTGCCAAGGCAGGTTATGGGGGTTACCTTTATCCACAATTCTACGACCATTCTTGC
CCCAAGGCTCAAGAGATAGTGAAGTCNGTGGTNGCCAAGGCCGTTGCGAAAGATCCTCGCATGGGCGCTTCACTCCTCCGCTTACATTTCCACGATTGCTTCGTTAAG
GGCTGCGACGCA
TCCTTATTGCTGGACAGCAGCGGCACTATAATCAGTGAGAAGCGGTCCGTCCCTAACACGAACTCAGCCAGAGGCTTTGAAGTGCTTGATGAGATCAAATTTGCACTGGAGAAGGAGTGC
CCTCAAACAGTGTCTTGTGCTGACCTGTTGGCCTTGGCTGCCAGAGACTCCACTGTTCTT
ACTNGTGGGCCTAGCTGGGTAGTGCCACTGGGAAGGAGGGACTCAACAGGAGCAAGCTTG
AGTGGCTCTAACAACAACATTCCTGCTCCAAACAACACTTTCCAGACCATTCTCACCAAGTTCAAGCTTAAAGGACTTGATATTGTTGATCTTGTTGCCCTCTCCG
GAAGCCACACAATT
GGAAATGCAAGATGCACCACCTTCAGGCAGAGGCTCTACAACCAGACAGGCAACGGGCAGCCCGACTTCACGCTCGACCAATCCTACGCNGCTCAGCTCCGCACCCGCTGCCCACGGTCC
GGGGGCGACCAGAACCTCTTCTTCTTGGACTTTGTCAGCCCGATAAAGTTCGACAACAGCTACTTCAAGAACCTGTTGGCTAAGAAGGGGCTCTTGAGCTCCGACGAAGTCCTCGTGACG
CAGAGCCAGGCCACGCTGCAGCTGGTGAAGCAGTATGCGGGGAACCAAGAGCTCTTCTTCGAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCACCCCACTGACAGGGTCCAAG
GGACAGATCAGGAAGCGTTGTAGGCAGGTCAATAAATAA

Retrieve as FASTA