Entry information : EguPrx138
Entry ID 11449
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx138
Name EguPrx138
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx138
start..stop
S start..stop
EgrPrx138 664 0 1..332 1..332
EglPrx178 664 0 1..332 1..332
EgrPrx178 664 0 1..332 1..332
EgrPrx177 659 0 1..332 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26874..27281 408 N° 2 27468..27630 163 N° 3 28052..28479 428  
join(26874..27281,27468..27630,28052..28479)


exon

Literature and cross-references EguPrx138
Protein sequence: EguPrx138
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (304)
PWM (Da):   %s   34881.52 (32089.1)  
PI (pH):   %s   8.15 (8.21) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGXFFPNKAALFXMLLTVCIAPTLVQGQGTRVGFYSSSCPRAEAIIRSTVQAHFKSDPTVAPGLLRMHFHDCFVQGCDGSILIDGPNAEKTAGPNRLLRGYEVIDDAKTQLEAACAGVVSCADILALAARDSVFLTNGRSWAVPTGRRDGRVSLASDTANLPGFRDSVDVQKKKFADLGLNTLDLVALVGGHTIGTGACQLFSYRLYNFTNTTSSGADASIDPSFVSQLRSLCPQNGDGTRRVALDTGSPSRFDASFFANLRSGRGVLESDQKLWTDASTKTFVQGFLSGQGXTXLDFNTEFAKSMVKMSNIGVKTGTNGEIRKICSAINA

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3). Scaffold_9_33182 (26874..28479)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTNGCTTCTTTCCCAACAAAGCCGCCTTGTTCANGATGCTTCTTACGGTATGCATTGCACCAACCTTGGTACAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTGATCCCACCGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGCCCAACGCTGAGAAAACGGCNGGTCCGAACCGTTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
GTACTTTATAATCTCGTGCTTCCATTTATTAGAGATCTNCGATATGAGTGCAAACCAATGTGGATCAATTTC
ATTCACTTCTACGCAAATCTTGGCGACGGCAACATGATTGATATCTTTTAATTGCAATGATTCTTCAAATATTTGAGATATCTTGAGTGATGTGATTCATGAAATTCAATGCAGACGAAT
GGACGAAGTTGGGCCGTGCCGACGGGACGNAGAGATGGGCGGGTCTCCTTGGCATCAGACACTGCAAATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGAC
TTAGGACTGAACACCCTTGATCTCGTTGCTCTNGTTG
GTCAGTATTTTCAATTTGTCGCCATTTCAATTTACTATCCTGCAGTACAGAAGTTGGCAACCGAATGCGTTATACTGCAGCAT
TTCCAAACCTAATTATTTTTCTCCCGTCTGCTGAATCTAAGGACAACTCCGCCCGTCGGTAGTTGTTATATTTCTTCTTGTCCTGTTGTTAAGGACGACTGTGGCTGTCCCTAAAATCTG
ATTAATCTTCTTTCTAATTTCCTTTAAGAGCTGTAAACATGAAGTTTATTTGTAAACATGAAGTTTATTTGTCATAGGCAAGANAGAATAGACATATTAAAAACTTGTCGACTTATTGCT
TCTTGCTATCTCGTAATTGAATCGAGTCTTCCCATATGTCCATGCGCATCAAAAGGGATACACTGAGTTTCTTTGCTTTTGACCAATACGCGATACAGGAGGGCACACCATAGGAACTGG
AGCTTGCCAGTTATTTAGCTACAGACTCTACAATTTCACCAATACTACATCAAGTGGAGCCGACGCTTCCATCGATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGG
TGATGGCACGAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCNGATCAGAAGCTATGGACNGA
TGCCTCCACCAAAACCTTCGTGCAGGGCTTTCTAAGCGGCCAAGGCNCGACCCNGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGCGTGAAGACGGG
GACCAATGGTGAAATTAGGAAAATATGCTCTGCCATTAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTNGCTTCTTTCCCAACAAAGCCGCCTTGTTCANGATGCTTCTTACGGTATGCATTGCACCAACCTTGGTACAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCGCGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTGATCCCACCGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGCCCAACGCTGAGAAAACGGCNGGTCCGAACCGTTTGTTGAGAGGATATGAAGTGATCGACGATGCAAAGACTCAGCTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
ACGAATGGACGAAGTTGGGCCGTGCCGACGGGACGNAGAGATGGGCGGGTCTCCTTGGCATCAGACACTGCA
AATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGACTTAGGACTGAACACCCTTGATCTCGTTGCTCTNGTTG
GAGGGCACACCATAGGAACTGGAGCTTGC
CAGTTATTTAGCTACAGACTCTACAATTTCACCAATACTACATCAAGTGGAGCCGACGCTTCCATCGATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGGTGATGGC
ACGAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCNGATCAGAAGCTATGGACNGATGCCTCC
ACCAAAACCTTCGTGCAGGGCTTTCTAAGCGGCCAAGGCNCGACCCNGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGCGTGAAGACGGGGACCAAT
GGTGAAATTAGGAAAATATGCTCTGCCATTAATGCATGA

Retrieve as FASTA