Entry information : OsPrx135 (Os12g02080)
Entry ID 1145
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Christophe Dunand)
Peroxidase information: OsPrx135 (Os12g02080)
Name (synonym) OsPrx135 (Os12g02080)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx135
start..stop
S start..stop
OsPrx130 610 0 1..327 1..324
SbPrx83 554 0 27..327 31..331
SbPrx84 553 0 25..327 26..328
SpPrx08 553 0 25..327 27..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 622704..622937 234 N° 2 623022..623213 192 N° 3 623285..623450 166 N° 4 624510..624901 392
join(622704..622937,623022..623213,623285..623450,624510..624901)


exon

Literature and cross-references OsPrx135 (Os12g02080)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1F8
DNA ref. GenBank:   NC_008405.1 (622704..624898)
EST ref. GenBank:   CT845111.1 [5' end]   CI190014.1 [3' end]
Cluster/Prediction ref. UniGene:   Os.11549
Protein sequence: OsPrx135 (Os12g02080)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (296)
PWM (Da):   %s   34692.44 (31514.7) Transmb domain:   %s   i12-34o
PI (pH):   %s   8.57 (8.20) Peptide Signal:   %s   cut: 32 range:32-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQPTWSARRVTAALVVMVVVVLAVAGGSWAQLSPSFYSYSCPGVFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLLLDDTASFTGEKTANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSWDVKVGRRDSRTASLSGANNNIPPPTSGLANLTSLFAAQALSQKDMVALSGSHTIGQARCTNFRAHIYNETNIDSGFAMRRQSGCPRNSGSGDNNLAPLDLQTPTVFENNYYKNLVVKKGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 12, 3 introns) and 31 ESTs. Unigene also contains ESTs from OsPrx130.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCCGACTTGGTCAGCAAGGCGCGTCACTGCCGCCCTGGTCGTGATGGTGGTGGTGGTGCTCGCGGTCGCCGGCGGGTCGTGGGCGCAGCTGTCGCCGAGCTTCTACTCGTAC
TCGTGCCCGGGAGTGTTCAACGCGGTGAAGCGGGGGATGCAGTCGGCCATCGCCAGGGAGAAGCGCATCGGCGCCTCCATCGTCCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GTAACC
ATCCTCTACCTAGTACAAGTATACGCACGCACACATTGATCATGCTATATAATTAATCTGTGCATGTATGAATGCCAGGGTTGCGACGCATCGCTGCTGCTGGACGACACGGCGAGCTTC
ACCGGCGAGAAGACGGCGAACCCCAACAACGGCTCCGTCAGAGGGTTTGAGGTGATCGACGCCATCAAGTCGGCGGTGGAGACCATCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTC
GCCATCGCTGCCAGGGACAGCGTCGCCATC
GTACGTACTCCACTTCGATCGATCGATCTCTATATACTGAAACTGAAACTGAAAATGGTACATATATGCAGCTGGGTGGGCCGAGCTGGG
ACGTGAAGGTTGGTCGGAGAGACTCGCGCACGGCGAGCCTCAGCGGCGCAAACAACAACATCCCGCCGCCGACGTCGGGACTCGCCAACCTCACCTCCCTCTTCGCCGCGCAGGCCCTCT
CCCAGAAGGACATGGTCGCCCTCTCCG
GTAACCACTGCTAGCTGTTACTAGTATTTTTGTTTCCACTGAGCATTCAATTAAGTCTAGCTTGTTAACTAACAAAAATAAAAATTTATAAAT
GCAAGCATCAATTCATTCACATAACTAAACGAACAAGCATCGTCAACTGTTCCATTTTTCAATCCCTTCTAGAAGGGAAAAGGAAAAAGGGTTCGGAACAACTTCATTTCACACTCTGTT
TCTGAATAGTATCAGTAGCTTTTGTGTCGATCTGCACACAGCTGGGTACCACGCAAACGGAACAGATAGCTACGTTTTCAATTTGCAGCATACTTGGCATTCTCCAAGCCTATACTACTT
TGACAAGATGATTAATTTACGAAAGTCTGCATAAACATCTCAGATTCAACTAGCAGTATAACCTCTGACTCTGAGTCCCCACTTGTCTCCCCTGTTTATTTTTTTTAAGAAAAAGAAAGA
TTCAGTGTCATCTGTTTAACATGCAATTTGTTAACTTACTTGTTAACCAAACAAAACGTAGTAGCAAAGTCGGTAAGCATGGTTGTCGATGGGATGGCATAAAGTTACTTTGAGGTAATG
ACGTACTCCTAACCGTGTCTGCGTTGTCGGTATGGGTTAATTTGCTTCTGAAGAAATAGTACAGGCTTTTCTTTTTAAGGTTCAGTAATCAGTACAGACTGCTGCCGATCGAAAAGATCA
GTCTGCCATCACATGCCGTGAATTGGCTAAATCACAAAAGCAAAAATTAATTTGTTTCCTAAAAAACCAAAAGCAAGAATAAAGTTGATAAACCCTGGCTACCCATCAAGTTATTAATTA
CAACCACAGATAATGTTCCTTTTGTTCTGTTTGTTAATAAATGTGATCGAATAATGTTGATTTTTTTTCTGTATTCCAATTAATATTAGGGAATGATGAAGAACCTATACTTTCTTTCTA
AAATAAAAATATTCACAATACTATACAAAAGCAAAGACCTAAAAGCTCAGCTCTTAAATATTCTAAATTATTCTTACACATATGCTCAGCTCTTAAGTATAGCATGATTTCATATTGTAC
CTGCAGGATCTCACACCATTGGGCAAGCACGATGCACAAACTTCAGAGCTCATATATACAACGAAACCAACATCGACAGTGGCTTTGCGATGAGGAGGCAATCAGGTTGCCCTCGTAACT
CAGGATCAGGTGACAATAACCTGGCACCTCTGGATCTTCAGACGCCAACCGTGTTCGAGAACAACTACTACAAGAACCTCGTCGTCAAGAAGGGGCTCCTGCATTCTGATCAGGAGCTCT
TCAATGGCGGAGCCACTGATGCTCTTGTTCAGTCTTACATAAGTAGCCAGAGCACATTCTTTGCGGATTTTGTGACGGGCATGATCAAGATGGGGGACATCACACCGTTGACGGGATCAA
ACGGGGAGATCAGGAAGAACTGCAGAAGGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCCGACTTGGTCAGCAAGGCGCGTCACTGCCGCCCTGGTCGTGATGGTGGTGGTGGTGCTCGCGGTCGCCGGCGGGTCGTGGGCGCAGCTGTCGCCGAGCTTCTACTCGTAC
TCGTGCCCGGGAGTGTTCAACGCGGTGAAGCGGGGGATGCAGTCGGCCATCGCCAGGGAGAAGCGCATCGGCGCCTCCATCGTCCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GGTTGC
GACGCATCGCTGCTGCTGGACGACACGGCGAGCTTCACCGGCGAGAAGACGGCGAACCCCAACAACGGCTCCGTCAGAGGGTTTGAGGTGATCGACGCCATCAAGTCGGCGGTGGAGACC
ATCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATCGCTGCCAGGGACAGCGTCGCCATC
CTGGGTGGGCCGAGCTGGGACGTGAAGGTTGGTCGGAGAGACTCGCGCACGGCG
AGCCTCAGCGGCGCAAACAACAACATCCCGCCGCCGACGTCGGGACTCGCCAACCTCACCTCCCTCTTCGCCGCGCAGGCCCTCTCCCAGAAGGACATGGTCGCCCTCTCCG
GATCTCAC
ACCATTGGGCAAGCACGATGCACAAACTTCAGAGCTCATATATACAACGAAACCAACATCGACAGTGGCTTTGCGATGAGGAGGCAATCAGGTTGCCCTCGTAACTCAGGATCAGGTGAC
AATAACCTGGCACCTCTGGATCTTCAGACGCCAACCGTGTTCGAGAACAACTACTACAAGAACCTCGTCGTCAAGAAGGGGCTCCTGCATTCTGATCAGGAGCTCTTCAATGGCGGAGCC
ACTGATGCTCTTGTTCAGTCTTACATAAGTAGCCAGAGCACATTCTTTGCGGATTTTGTGACGGGCATGATCAAGATGGGGGACATCACACCGTTGACGGGATCAAACGGGGAGATCAGG
AAGAACTGCAGAAGGATTAATTAA

Retrieve as FASTA