Entry information : EguPrx145
Entry ID 11453
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx145
Name EguPrx145
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx145
start..stop
S start..stop
EgrPrx145 603 0 1..331 1..331
EglPrx145 597 0 33..331 33..331
PtPrx68 538 0 12..331 3..322
PbPrx68 536 0 12..331 3..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11991..12236 246 N° 2 11043..11234 192 N° 3 10747..10912 166 N° 4 10215..10603 389
complement(join(10215..10603,10747..10912,11043..11234,11991..12236))


exon

Literature and cross-references EguPrx145
Protein sequence: EguPrx145
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (296)
PWM (Da):   %s   34543.25 (31144.6)  
PI (pH):   %s   8.56 (8.93) Peptide Signal:   %s   cut: 36 range:36-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSSPPSSSSSSSCSVAVLSLSCILLLLLGSTDAQLSTNFYSKTCPNVFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSILLDDTSTFTGEKNAAPNKNSARGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPXWXVKVGRRDARTASQAAANXSIPPPTSNLNNLISFFQNVGLSTXDMVALSGSHTIGQARCTNFRXRIYNETNLDSSLAQTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYKNLLQNKGLLHSDQQLFXGGSTDSLVRTYGSNPSTFTSDFVAGMIKMGDIKPLTGSSGEIRKNCRKI

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_10_3331 (10215..12236).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTTTCTTCGCCCCCATCATCATCATCATCATCATCATGTTCCGTGGCCGTTTTGTCTTTGTCCTGCATCTTGCTTCTCCTCCTGGGGAGCACCGATGCCCAACTTTCCACTAAT
TTTTACTCAAAGACGTGCCCCAACGTCTTCACCACGGTCAAATCCCAGGTGCAAGCGGCCATCAACAAGGAGGCCCGGATGGGTGCCTCTCTCCTCCGCCTATTCTTCCACGATTGCTTT
GTTAAT
GTAAACCGACCATAACCATTCTTCTTAGTTGTTTTTCATCTAATCGATTACGTTGAGTTTCCATTCTTTCCCATTTTCAAAATGCATCCAAGTAATTGTGGGGGATGTACATGT
CGCCTAAGTGTTTCGCATGTCCATTCATTCGCCCCGGTCCTTAGAGTTTAGTTCTTGGGTGTTAAGCGTGATCACTAATGTACAACCTTTTAGATAAAGTTCTTATGAGCCATGTTACGT
AAATAAACCATGTTAAGTAACCACAAGCATGAGCACTAAATCTGGGACTCGTTTGCCAAGTATGCTCGTGTATATATTCATGCCCTAGTCGGGTAAGATGTATTTGCTTCAATCTTTTGT
TTTTGTGGTTCAAATGAATTCACATGCACGTCTCTTTCGGGAGGTTCGTGCATGGCGCTGAAAACGAACACGTTTGTTTGGAAATCATGCATTTTTACTGACAAGCCTAGTTAATATCGT
TTCCACATTTGTGTCCCCAGCTACATGCCTAAAACATAAACCCAGTCCACGCGGTTCCTTCCTATATCGAGAAAGACCGGAAAATTAGTCTGCTTATGGAGCTGTAGTGTTGTTCAACTA
AGGTGTGAACTGTGAAATAAGCCTACCAGCAAAGATCACCATTTAATTAAACAACAAACCAAATAGGCTACCTTTTAGATTAATTGACTAATCTTTCTTTACATTGTCTTCACGTGTATC
CTTGGAAATTCATTTATCCCCCTCTTGCGGCTATTCCCACAGGGCTGCGACGGATCAATTCTTCTAGATGACACGTCCACATTCACCGGAGAAAAGAACGCAGCTCCAAACAAAAACTCC
GCCAGAGGATTCGATGTCGTAGACAACATCAAATCTGCTGTGGAGAAGGTGTGCCCCGGCGTCGTTTCCTGCGCTGACTTGTTGGCCATCACTGCCCGAGACTCCACCGTCATC
GTAAGC
CCTTCTATCCCTCCATAATTTTTCTTTTTTTTCAAAAAAACTATTAAATACAGGTACCAATCGCAAATTGGCCATAGCTAANGNCTATTATAGAATATAACTAAGATCATGTCAAAATTT
GCAGCTTGGAGGGCCAAGNTGGAANGTGAAAGTCGGGAGGAGAGATGCAAGGACCGCAAGCCAAGCTGCTGCNAACAANAGCATTCCTCCCCCGACCTCAAACCTCAACAACCTCATCTC
TTTCTTCCAAAATGTGGGCCTCTCCACTAGNGACATGGTGGCTTTATCTG
GTATGTACACTCATAAACACAATNCNAGATCNGCGCAATTCATCCCTAGGAAAATCATATAAAAAAACAT
NTTCTTTACTTTGATTGTAAGTTGACAAAAAAAACAAAAAAAAAATACTAAATCACCAAATCCGTAAAAACAGGTTCACATACAATAGGACAAGCAAGGTGCACAAACTTCAGAGNCAGG
ATTTACAATGAAACCAACCTGGACTCTTCCTTGGCCCAGACAAGGCAGAGCAACTGCCCGAGGACAGTTGGCTCAGGAGACAACAATCTAGCCCCTCTCGACTTGCAAACTCCCACCAAG
TTTGACAACAATTACTACAAGAACCTCCTCCAGAACAAGGGCTTGCTCCACTCCGACCAGCAGCTCTTCAANGGCGGTTCTACCGACTCGCTCGTGAGGACTTACGGCAGCAACCCNAGC
ACCTTCACCTCNGACTTCGTGGCGGGCATGATCAAGATGGGGGATATCAAGCCCCTCACTGGATCAAGTGGTGAAATCAGGAAGAATTGCAGGAAGATCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTTTCTTCGCCCCCATCATCATCATCATCATCATCATGTTCCGTGGCCGTTTTGTCTTTGTCCTGCATCTTGCTTCTCCTCCTGGGGAGCACCGATGCCCAACTTTCCACTAAT
TTTTACTCAAAGACGTGCCCCAACGTCTTCACCACGGTCAAATCCCAGGTGCAAGCGGCCATCAACAAGGAGGCCCGGATGGGTGCCTCTCTCCTCCGCCTATTCTTCCACGATTGCTTT
GTTAAT
GGCTGCGACGGATCAATTCTTCTAGATGACACGTCCACATTCACCGGAGAAAAGAACGCAGCTCCAAACAAAAACTCCGCCAGAGGATTCGATGTCGTAGACAACATCAAATCT
GCTGTGGAGAAGGTGTGCCCCGGCGTCGTTTCCTGCGCTGACTTGTTGGCCATCACTGCCCGAGACTCCACCGTCATC
CTTGGAGGGCCAAGNTGGAANGTGAAAGTCGGGAGGAGAGAT
GCAAGGACCGCAAGCCAAGCTGCTGCNAACAANAGCATTCCTCCCCCGACCTCAAACCTCAACAACCTCATCTCTTTCTTCCAAAATGTGGGCCTCTCCACTAGNGACATGGTGGCTTTA
TCTG
GTTCACATACAATAGGACAAGCAAGGTGCACAAACTTCAGAGNCAGGATTTACAATGAAACCAACCTGGACTCTTCCTTGGCCCAGACAAGGCAGAGCAACTGCCCGAGGACAGTT
GGCTCAGGAGACAACAATCTAGCCCCTCTCGACTTGCAAACTCCCACCAAGTTTGACAACAATTACTACAAGAACCTCCTCCAGAACAAGGGCTTGCTCCACTCCGACCAGCAGCTCTTC
AANGGCGGTTCTACCGACTCGCTCGTGAGGACTTACGGCAGCAACCCNAGCACCTTCACCTCNGACTTCGTGGCGGGCATGATCAAGATGGGGGATATCAAGCCCCTCACTGGATCAAGT
GGTGAAATCAGGAAGAATTGCAGGAAGATCAAC

Retrieve as FASTA