Entry information : EguPrx146
Entry ID 11454
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx146
Name EguPrx146
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx146
start..stop
S start..stop
EcamPrx146 615 0 1..323 1..323
EgrPrx146 613 0 1..323 1..323
EglPrx146 585 0 1..323 1..319
EguPrx62 447 3e-159 1..320 4..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3076..3294 219 N° 2 3413..3592 180 N° 3 3706..3865 160 N° 4 3956..4365 410
join(3076..3294,3413..3592,3706..3865,3956..4365)


exon

Literature and cross-references EguPrx146
Protein sequence: EguPrx146
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (299)
PWM (Da):   %s   33269.42 (30945.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.16 (9.12) Peptide Signal:   %s   cut: 25 range:25-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTGSRLALALALVLSTIAPPCSAALXAGFYKGKCGLVDVESVVATIVASRFSKDPSIVAALLRLQFHDCFVNGCDASILLXGSSSEKTAGPNLSVRGYDLIDAAKAAVEAICPGVVSCADIIVMATRDAVALAKGGRYSVQTGRLDGKISLAQNVNLPGPSMTVSQAAXAFARKGFTISDMVILLGGHTVGITHCSLFQDRLYNFNGLGKPDPTMDPKLVAALRXRCPQTATIDNTVNLDQNSSSALVVDNSFYKQXVARRGILQIDQELAVDRLSKSLVATLANATNFSARFGLAMVKLGGLQSRLPGEIRSSCRAINKR

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_10_33502 (3076..4365)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGACGGGAAGTAGATTGGCGTTGGCCCTCGCTCTCGTCCTCTCGACCATCGCGCCCCCATGCTCCGCCGCTCTCNGGGCAGGGTTCTACAAAGGCAAGTGTGGCCTTGTGGATGTC
GAGTCCGTGGTCGCGACCATCGTGGCCTCCCGGTTCTCCAAGGACCCGTCCATTGTGGCCGCGCTGCTCCGGTTGCAGTTCCACGATTGCTTCGTCAAT
GTATGTAAATCTTTGCATAAT
TCGATCCTCTACTTCCAGAGCACGTACTTCCGATGTACTCTAAAGCCGTCGTGATGACCGATCGATGCTAATGTTGCGTCCTTTTTTCCCCTTGAAGGGCTGTGACGCGTCGATCCTGCT
AGANGGGAGCTCGAGCGAGAAAACGGCGGGGCCGAATTTGAGCGTGAGGGGCTACGATCTTATCGACGCAGCCAAGGCNGCGGTCGAGGCCATCTGCCCCGGAGTCGTTTCTTGCGCCGA
CATCATCGTCATGGCAACTCGGGACGCTGTCGCTTTG
GTAATGGAAAGAAAAATTACTTCAAACCCCATCGTACCCGATTCGAATTCGGTCGTGTCATGTTCGGATTAGCCCTAATGCTA
TCTCGAAAATTCATTTTCGTTCAATTTCAGGCCAAAGGAGGAAGGTACAGTGTGCAAACGGGGAGGCTGGATGGCAAGATATCGCTGGCCCAAAATGTGAATCTCCCAGGTCCTTCCATG
ACAGTTTCTCAGGCTGCTTNGGCCTTTGCTCGAAAGGGATTCACCATCTCCGACATGGTCATTCTTCTAG
GTACCGACGGTGTATGCTATAATTATACTAATCGCTTTTGGTAGACGGCT
TCGGACTTAACTTATATACGCATCATNCGGACTTCGTCANGTGGCCACACTGTCGGGATTACGCACTGCTCCCTCTTCCAAGACCGGCTCTACAACTTCAACGGATTGGGGAAGCCCGAC
CCGACCATGGATCCTAAGCTCGTGGCTGCCCTCCGGNCGAGGTGCCCGCAGACCGCGACCATCGATAACACCGTGAACCTGGACCAGAATTCTTCGAGCGCGCTCGTCGTCGACAATTCC
TTCTACAAGCAANTAGTCGCCCGGAGAGGGATTCTGCAGATCGACCAAGAGCTAGCAGTCGATAGGCTGAGCAAGTCCCTGGTGGCGACGCTGGCCAATGCCACCAACTTCTCCGCTCGG
TTCGGCCTCGCCATGGTCAAGCTGGGTGGTCTCCAGAGCCGCTTGCCCGGCGAAATTAGGAGTTCTTGCCGAGCCATAAACAAAAGGAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGACGGGAAGTAGATTGGCGTTGGCCCTCGCTCTCGTCCTCTCGACCATCGCGCCCCCATGCTCCGCCGCTCTCNGGGCAGGGTTCTACAAAGGCAAGTGTGGCCTTGTGGATGTC
GAGTCCGTGGTCGCGACCATCGTGGCCTCCCGGTTCTCCAAGGACCCGTCCATTGTGGCCGCGCTGCTCCGGTTGCAGTTCCACGATTGCTTCGTCAAT
GGCTGTGACGCGTCGATCCTG
CTAGANGGGAGCTCGAGCGAGAAAACGGCGGGGCCGAATTTGAGCGTGAGGGGCTACGATCTTATCGACGCAGCCAAGGCNGCGGTCGAGGCCATCTGCCCCGGAGTCGTTTCTTGCGCC
GACATCATCGTCATGGCAACTCGGGACGCTGTCGCTTTG
GCCAAAGGAGGAAGGTACAGTGTGCAAACGGGGAGGCTGGATGGCAAGATATCGCTGGCCCAAAATGTGAATCTCCCAGGT
CCTTCCATGACAGTTTCTCAGGCTGCTTNGGCCTTTGCTCGAAAGGGATTCACCATCTCCGACATGGTCATTCTTCTAG
GTGGCCACACTGTCGGGATTACGCACTGCTCCCTCTTCCAA
GACCGGCTCTACAACTTCAACGGATTGGGGAAGCCCGACCCGACCATGGATCCTAAGCTCGTGGCTGCCCTCCGGNCGAGGTGCCCGCAGACCGCGACCATCGATAACACCGTGAACCTG
GACCAGAATTCTTCGAGCGCGCTCGTCGTCGACAATTCCTTCTACAAGCAANTAGTCGCCCGGAGAGGGATTCTGCAGATCGACCAAGAGCTAGCAGTCGATAGGCTGAGCAAGTCCCTG
GTGGCGACGCTGGCCAATGCCACCAACTTCTCCGCTCGGTTCGGCCTCGCCATGGTCAAGCTGGGTGGTCTCCAGAGCCGCTTGCCCGGCGAAATTAGGAGTTCTTGCCGAGCCATAAAC
AAAAGGAGT

Retrieve as FASTA