Entry information : EguPrx148
Entry ID 11455
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-10-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx148
Name EguPrx148
Class Class III peroxidase    [Orthogroup: Prx212]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx148
start..stop
S start..stop
EglPrx148 616 0 2..322 2..322
EgrPrx148 602 0 2..322 2..322
EgrPrx[P]147 570 0 11..322 1..312
EguPrx[P]147 568 0 11..322 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4103..4321 219 N° 2 3821..4012 192 N° 3 3564..3729 166 N° 4 3030..3421 392
complement(join(3030..3421,3564..3729,3821..4012,4103..4321))


exon

Literature and cross-references EguPrx148
Protein sequence: EguPrx148
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (296)
PWM (Da):   %s   33035.24 (30377.0)  
PI (pH):   %s   4.96 (5.12) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
XAPSSCFVALFTLSCTLLLLMGCSDAQLSPDFYSKSCPDVFTGVKSQVESAVSKEPGMGASLLRLFFHDCFVNGCDGSVLLDDTPTFTGEKNAAPNRNSARGFEVIDDVKSAVEKXCPGVVSCXDLLAITARDSVVLLGGPSWXXKLGRRDARTASQXAANXXLPSPASNLXDLISSFENAGLSTTDLVALSGSHSIGQAXCXNFRARIYNETDLDRSFGEIRRKNCPSSAGPGDNNLAPLDLQSPVAFDNTYYTNLLQFKGLLHSDQQLFSGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGEVRKNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. scaffold_10_33946 (3030..4321)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ANGGCACCATCATCATGTTTTGTGGCCCTTTTCACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTCTCCCCTGATTTTTATTCAAAATCGTGTCCCGACGTC
TTCACCGGGGTCAAATCCCAGGTGGAATCCGCTGTTAGCAAGGAACCTGGAATGGGAGCCTCCCTCCTCCGCCTGTTCTTCCACGATTGCTTTGTGAAT
GTAAGCTACCTTAAATTGACT
TTATCTTTCTTTCATTGTCTTCACACATATCCTAGAAATTAATTTCTTGTCTTTCGTCTATTGCCANAGGGCTGCGATGGATCGGTTCTTCTCGACGACACGCCNACGTTCACTGGTGAA
AAGAACGCAGCTCCAAACCGAAACTCTGCCAGAGGATTTGAGGTCATAGACGATGTCAAGTCTGCTGTGGAGAAAGNGTGCCCCGGTGTTGTTTCTTGCNCTGACTTGTTGGCCATCACC
GCTCGTGACTCCGTCGTCTTG
GTAAGCCCTCCCAATCCCTTTAAAAAAATCACTACCCCATATAAGTACTACTCACGAATTTGCTCTAACTAAGATTGTGTAAAATTTGCAGCTTGGAGG
GCCAAGCTGGAANNTGAAACTCGGGAGGAGAGATGCAAGAACCGCNAGCCAAGNAGCTGCTAACNGTAGNCTTCCCTCTCCAGCCTCAAACCTTANCGACCTAATATCTAGCTTTGAAAA
TGCTGGCCTCTCCACGACAGACTTGGTGGCTTTATCTG
GTACGTACACTCATAAACACAATCCNGGACGGTCGCNGGAGTAATAATGCAAAAAGCATTTTCTTTTATTTTTTTATTGTAA
ATGGAGAAAAAAAGAAAAAGAAAAAAAAGANATACTAACTTATCATATCTGTTTTGACAGGTTCACATTCGATAGGGCAAGCGNAATGTGNAAATTTCAGAGCCCGGATCTACAATGAGA
CCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAACTGCCCAAGCTCAGCTGGCCCGGGGGACAACAATCTAGCCCCACTCGACCTGCAGTCTCCCGTTGCATTTGACAACACTT
ACTACACCAACCTTCTCCAATTCAAAGGACTGCTTCACTCCGACCAGCAGCTCTTCAGTGGCGGCTCCACGGACTCACTGGTGAGGACATATGCCAGCAGCCCGAGCACCTTCAGCTCTG
ACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCCCTCACCGGATCAGATGGCGAAGTCAGGAAGAACTGTAGGAAGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ANGGCACCATCATCATGTTTTGTGGCCCTTTTCACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTCTCCCCTGATTTTTATTCAAAATCGTGTCCCGACGTC
TTCACCGGGGTCAAATCCCAGGTGGAATCCGCTGTTAGCAAGGAACCTGGAATGGGAGCCTCCCTCCTCCGCCTGTTCTTCCACGATTGCTTTGTGAAT
GGCTGCGATGGATCGGTTCTT
CTCGACGACACGCCNACGTTCACTGGTGAAAAGAACGCAGCTCCAAACCGAAACTCTGCCAGAGGATTTGAGGTCATAGACGATGTCAAGTCTGCTGTGGAGAAAGNGTGCCCCGGTGTT
GTTTCTTGCNCTGACTTGTTGGCCATCACCGCTCGTGACTCCGTCGTCTTG
CTTGGAGGGCCAAGCTGGAANNTGAAACTCGGGAGGAGAGATGCAAGAACCGCNAGCCAAGNAGCTGCT
AACNGTAGNCTTCCCTCTCCAGCCTCAAACCTTANCGACCTAATATCTAGCTTTGAAAATGCTGGCCTCTCCACGACAGACTTGGTGGCTTTATCTG
GTTCACATTCGATAGGGCAAGCG
NAATGTGNAAATTTCAGAGCCCGGATCTACAATGAGACCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAACTGCCCAAGCTCAGCTGGCCCGGGGGACAACAATCTAGCCCCA
CTCGACCTGCAGTCTCCCGTTGCATTTGACAACACTTACTACACCAACCTTCTCCAATTCAAAGGACTGCTTCACTCCGACCAGCAGCTCTTCAGTGGCGGCTCCACGGACTCACTGGTG
AGGACATATGCCAGCAGCCCGAGCACCTTCAGCTCTGACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCCCTCACCGGATCAGATGGCGAAGTCAGGAAGAACTGTAGGAAG
ATCAATTAA

Retrieve as FASTA