Entry information : EguPrx149
Entry ID 11456
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx149
Name EguPrx149
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx149
start..stop
S start..stop
EgrPrx149 624 0 1..309 1..309
EglPrx149 608 0 1..309 1..309
EguPrx150 583 0 1..309 1..309
EgrPrx150 577 0 1..309 1..309
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5727..5888 162 N° 2 6116..6880 765  
join(5727..5888,6116..6880)


exon

Literature and cross-references EguPrx149
Protein sequence: EguPrx149
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   309
PWM (Da):   %s   32674.28  
PI (pH):   %s   8.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLNSGSATLQVGFYHSTCPSVESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDSTPGNPAEKEHPANNPSLRGYEVIDEAKAELEYLCPQTXSCADILAFAARDSTYKLGSINYAVPAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSRXEMVTLSGAHSVGVSHCSSFSTRLSSFNATHKQDPSXEPRMASXLKAKCLNNGGASDPTVPLDFATPNRLDNKYYTNLKNHRGVLTSDQTLFDSPSTAYXVRKHANRGGAWANKFAAAMVKMGSIDILTGNQGEIRRNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1). Scaffold_10_34441 (5727..6880) .
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGAACTCAGGTTCGGCGACTCTCCAAGTGGGATTCTACCACTCCACCTGCCCGTCCGTGGAGTCCGTCGTTCGAAAAGCCGTGAACAAGGCGGTGGCCAGAAATCCCGGCATTGGT
GCTGGGCTTATTAGAATGCACTTCCATGATTGCTTTGTTCGG
GTATGCAAACACTTCTTGCCACATTTCTGAAGTAGCAGTGACNATCTCAATTTCGATAANTAGCAGCGGCTNTAAACT
TTTCCTAGTGAAAAGCATTCTTGTGATATTTTTTTTATAACAAAGGATGTTAACTAGATGTGAGTATAGAGTACAATAGTAACGTAATTCCTTATGCAGATGCATTTCAGCAATCCTGAT
AATGTTCCTGTTTTCTGATACAATAATAGGGTTGCGATGCATCAATTTTGCTCGATTCAACACCGGGCAACCCAGCAGAGAAGGAACATCCCGCGAACAACCCAAGCTTACGAGGCTACG
AAGTCATTGACGAGGCAAAGGCCGAGCTAGAGTATCTATGCCCCCAGACGNTCTCTTGCGCCGACATTCTCGCGTTCGCGGCCCGNGACAGCACCTACAAGCTTGGCAGCATTAACTATG
CAGTCCCGGCCGGTCGCCGTGATGGGCTAGTCTCCCTCAGAGACGAGCCGTCCCAGAATCTTCCCCCTCCTTCCTTAGATGCTCAACAGTTGGAAGCTAATTTCGCAAGAAAAGGTCTCT
CTCGAGANGAAATGGTGACACTATCCGGTGCGCATTCGGTTGGAGTCTCGCACTGTTCCTCCTTCTCGACCCGCTTGTCCTCCTTCAACGCCACGCACAAGCAAGACCCTTCANTGGAAC
CCAGGATGGCCAGTGNACTGAAAGCGAAGTGCCTGAACAACGGAGGTGCCAGCGATCCGACGGTCCCACTGGACTTTGCCACGCCCAACAGGCTCGACAACAAGTACTACACTAATTTGA
AGAACCACCGAGGCGTATTAACTTCCGATCAGACACTTTTTGATAGCCCTTCGACAGCATATATNGTGAGGAAGCACGCGAATCGTGGCGGAGCATGGGCTAACAAGTTCGCAGCTGCTA
TGGTAAAGATGGGATCGATCGATATTCTCACCGGGAACCAGGGCGAGATTAGGAGAAATTGCAGAGTTGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGAACTCAGGTTCGGCGACTCTCCAAGTGGGATTCTACCACTCCACCTGCCCGTCCGTGGAGTCCGTCGTTCGAAAAGCCGTGAACAAGGCGGTGGCCAGAAATCCCGGCATTGGT
GCTGGGCTTATTAGAATGCACTTCCATGATTGCTTTGTTCGG
GGTTGCGATGCATCAATTTTGCTCGATTCAACACCGGGCAACCCAGCAGAGAAGGAACATCCCGCGAACAACCCAAGC
TTACGAGGCTACGAAGTCATTGACGAGGCAAAGGCCGAGCTAGAGTATCTATGCCCCCAGACGNTCTCTTGCGCCGACATTCTCGCGTTCGCGGCCCGNGACAGCACCTACAAGCTTGGC
AGCATTAACTATGCAGTCCCGGCCGGTCGCCGTGATGGGCTAGTCTCCCTCAGAGACGAGCCGTCCCAGAATCTTCCCCCTCCTTCCTTAGATGCTCAACAGTTGGAAGCTAATTTCGCA
AGAAAAGGTCTCTCTCGAGANGAAATGGTGACACTATCCGGTGCGCATTCGGTTGGAGTCTCGCACTGTTCCTCCTTCTCGACCCGCTTGTCCTCCTTCAACGCCACGCACAAGCAAGAC
CCTTCANTGGAACCCAGGATGGCCAGTGNACTGAAAGCGAAGTGCCTGAACAACGGAGGTGCCAGCGATCCGACGGTCCCACTGGACTTTGCCACGCCCAACAGGCTCGACAACAAGTAC
TACACTAATTTGAAGAACCACCGAGGCGTATTAACTTCCGATCAGACACTTTTTGATAGCCCTTCGACAGCATATATNGTGAGGAAGCACGCGAATCGTGGCGGAGCATGGGCTAACAAG
TTCGCAGCTGCTATGGTAAAGATGGGATCGATCGATATTCTCACCGGGAACCAGGGCGAGATTAGGAGAAATTGCAGAGTTGTGAAC

Retrieve as FASTA