Entry information : EguPrx150
Entry ID 11458
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-23 (Christophe Dunand)
Peroxidase information: EguPrx150
Name EguPrx150
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx150
start..stop
S start..stop
EgrPrx150 625 0 1..309 1..309
EcamPrx150 613 0 1..309 16..325
EgrPrx152 610 0 1..309 1..309
EguPrx152 609 0 1..309 1..309
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10282..10443 162 N° 2 10586..11353 768  
join(10282..10443,10586..11353)


exon

Literature and cross-references EguPrx150
Protein sequence: EguPrx150
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   310
PWM (Da):   %s   33197.62  
PI (pH):   %s   8.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLNSGSATLQVGFYRSTCPAAESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDSTPGNPSEKEHPANNPXLRGYEVIDEAKAELEYLCPSTVSCADILAFAARDSTYKLGSINYAVPAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSFSNRLYSFNATHKRDPSMEPKLASELKAKCPNNGGTSDPTVPLDFVTPNRLDNKYYTNLKKHRGVLTSDQTLFNSPSTAHIVRRNANHGGAWANKFAAAMVKMGSIDVLTGSQGEIRRNCRVVNX

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1). Scaffold_10_34441 (10282..11352).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGAACTCAGGTTCAGCAACTCTCCAAGTCGGATTCTACCGCTCCACTTGCCCGGCTGCGGAGTCTGTCGTTCGAAAAGCCGTGAACAAGGCGGTGGCCAGAAATCCCGGCATTGGT
GCTGGGCTTATTAGAATGCACTTCCATGATTGCTTTGTTCGG
GTATGCAAACACTTCTTACAACATTTCTNAAGTAGCAGTAACAATCTCGATTTCANTAAGCAGTAACTTAATAATCGA
CGTTCCTTATGCAGATGCATTTCAGCAATTCTGATGATTTTCGTATTTTTTGAAACAATTATAGGGTTGCGATGCATCNATTTTGCTCGATTCAACACCGGGCAACCCATCAGAGAAGGA
GCATCCNGCGAACAACCCAANCTTACGAGGCTACGAAGTCATCGACGAGGCGAAGGCCGAGCTAGAGTATCTATGCCCCTCGACGGTCTCCTGTGCCGATATTCTGGCATTCGCAGCCCG
CGACAGCACCTACAAGCTGGGCAGCATTAACTACGCAGTCCCGGCTGGTCGCCGCGATGGNCTAGTCTCCCTCAGAGACGAGCCGTCCCAGAATCTTCCCCCTCCTTCCTTGGATGCTCA
ACAGTTAGAAGCTAATTTTGCAAGGAAAGGTCTCTCTCTAGACGAAATGGTGACACTATCCGGTGCGCATTCGATCGGAGTCTCGCACTGTTCCTCCTTCTCGAACCGCTTGTACTCCTT
CAACGCCACTCACAAGCGAGACCCTTCAATGGAACCCAAGTTGGCCAGTGAACTGAAAGCGAAGTGTCCGAACAATGGNGGTACCAGCGACCCGACGGTCCCATTGGACTTTGTCACTCC
CAACAGGCTCGACAACAAGTACTACACTAATTTAAAGAAACACCGAGGCGTATTGACTTCAGATCAAACGCTTTTTAATAGCCCTTCGACGGCACATATTGTGAGGAGGAACGCTAATCA
TGGCGGAGCATGGGCTAACAAATTTGCAGCTGCAATGGTGAAGATGGGATCAATCGATGTTCTCACNGGGAGCCAGGGCGAGATTAGGAGGAATTGCAGAGTTGTGAACTNT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGAACTCAGGTTCAGCAACTCTCCAAGTCGGATTCTACCGCTCCACTTGCCCGGCTGCGGAGTCTGTCGTTCGAAAAGCCGTGAACAAGGCGGTGGCCAGAAATCCCGGCATTGGT
GCTGGGCTTATTAGAATGCACTTCCATGATTGCTTTGTTCGG
GGTTGCGATGCATCNATTTTGCTCGATTCAACACCGGGCAACCCATCAGAGAAGGAGCATCCNGCGAACAACCCAANC
TTACGAGGCTACGAAGTCATCGACGAGGCGAAGGCCGAGCTAGAGTATCTATGCCCCTCGACGGTCTCCTGTGCCGATATTCTGGCATTCGCAGCCCGCGACAGCACCTACAAGCTGGGC
AGCATTAACTACGCAGTCCCGGCTGGTCGCCGCGATGGNCTAGTCTCCCTCAGAGACGAGCCGTCCCAGAATCTTCCCCCTCCTTCCTTGGATGCTCAACAGTTAGAAGCTAATTTTGCA
AGGAAAGGTCTCTCTCTAGACGAAATGGTGACACTATCCGGTGCGCATTCGATCGGAGTCTCGCACTGTTCCTCCTTCTCGAACCGCTTGTACTCCTTCAACGCCACTCACAAGCGAGAC
CCTTCAATGGAACCCAAGTTGGCCAGTGAACTGAAAGCGAAGTGTCCGAACAATGGNGGTACCAGCGACCCGACGGTCCCATTGGACTTTGTCACTCCCAACAGGCTCGACAACAAGTAC
TACACTAATTTAAAGAAACACCGAGGCGTATTGACTTCAGATCAAACGCTTTTTAATAGCCCTTCGACGGCACATATTGTGAGGAGGAACGCTAATCATGGCGGAGCATGGGCTAACAAA
TTTGCAGCTGCAATGGTGAAGATGGGATCAATCGATGTTCTCACNGGGAGCCAGGGCGAGATTAGGAGGAATTGCAGAGTTGTGAACTNT

Retrieve as FASTA