Entry information : EguPrx156
Entry ID 11464
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx156
Name EguPrx156
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx156
start..stop
S start..stop
EglPrx156 664 0 1..326 1..326
EcamPrx156 659 0 1..326 1..326
EgrPrx156 635 0 1..326 1..326
VvPrx65 519 0 7..326 7..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6297..6509 213 N° 2 7636..7827 192 N° 3 7944..8516 573  
join(6297..6509,7636..7827,7944..8516)


exon

Literature and cross-references EguPrx156
Protein sequence: EguPrx156
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   34749.33 (32239.9) Transmb domain:   %s   i5-22o
PI (pH):   %s   5.12 (4.80) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARKLGLWLVVVFAVAATAEVGRAQLTEGFYGQTCPNVESIVKQAVTTKFGQTFVTIPGTLRLFFHDCFIEGCDASILISSPNGDAEKDAPDNQSLAGDGFDTVIKAKQAVEASCQGVVSCADILAIAARDVVVLAGGPSFNVELGRRDGLISKASLVAGKLPEPNFDLDQLNAIFSQHNLTQSDMIALSGAHTLGFSHCDRFANRLYSFSSSSPVDPTLNSTYAVQLMQECPQNVDPQIAINMDPVTPRTFDNMYYTNLVQGKGLFTSDEXLFTDSASKPTVLNFANSPGSFNRAFATAMRKLGRVGIKTGSQGEIRRDCTAFNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Scaffold_10_34950 (6297..8516)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGAAACTAGGACTTTGGTTGGTGGTGGTTTTTGCGGTGGCGGCCACGGCGGAGGTGGGAAGAGCGCAACTGACGGAGGGTTTCTATGGCCAGACCTGCCCAAACGTCGAGAGC
ATCGTGAAGCAGGCGGTAACGACCAAGTTCGGCCAGACCTTCGTCACCATCCCCGGCACGCTCCGCCTCTTCTTCCACGATTGCTTCATCGAG
GTGATTCCCTTTTCCTCCATGCATGCA
TTTCCGATCATGCTGCCTCCTCCTCCTTTTTCAGTTTCATCTGATTAATCACACATGTGTAACCCTGGCAAGTAATAGCCTTTCGATCACAGTTCCAAAAGCCCTGAATCAATTGCTAAT
CCATTCGATGAACTCTCATTTCCACAATCTTTCGGATATTCGTCCAGTCTTACACCGTAATATTTTCTTTTTCGGTATTTCTTCATGAATATTTTTCTTTAAGTAAAAAGGGAATTAGAA
TGTACATGGATTATCGTTACTTCTTCCACAATGTTATCCAAGTTTTTTAGACGGTCAAAATTGCCGCTCGTTCTTTGCTTGAGCTGAGCCGGAGTTTGAACATTTGGCGAGGTTCTATCC
TAACATCGTACAAATTATATCAATTATATAGAGGAATCATAAGGAACAAGAAGTTGACTTTGGAACACATGTTATACGTTTTCAATCATTTCATGGACAAAATGAGACGTTTTCATCTAC
CCCAATATTTTCCCGACCAAAAAAAAAAAAAAAAAACTGCCCCAATATTTTAACGAGCTTTCTCACAGAGCCCCAACCACGCCTTTTGAATTAATTAATCGCAATTTGTCGAAATTAATT
GTGACAACAATTTAATTAAGGGAATCAAAAGCATTCCAAGTGAAATTGCCAAACAGAGATATTTTTCCAGGGGGCAGGTAAGTGCATAACTAGTCGCACAAGACAACACAAGAACAATTG
AAAGAAAATGAAATTGAATCACATGGATCAACAATCGCGTTCACATTCACTCGTTATTAAGTCTTGGCGTATGAAAAACTCTCATATATTCGAGTTAGCACTAACCCTTAAACGGGCATC
GTTGTATTGATTTTCCTTATCTTGGACTTAATTGTGTGATGATTTGTCGGGCTTGGTCACGCATTAAACTAGGAGATATGTAAAAAGATTAGAAACCTTAAATCTACTCCGCGAACTCGC
TTTTCAGGGTCCGATCATGTTCATAAAATATGTCCTGGGAGGTATGAATTAGTTCAGGATTACTTTAGATAAGAAACGCATGATATGAATTTTCATTCAATCACGGTTTCGGCTAGTTAA
TTTCGATGTTGTTTTTAAGGGATGCGATGCTTCGATTTTGATCTCGTCGCCTAATGGGGATGCTGAGAAAGACGCGCCGGATAATCAGTCTCTAGCCGGAGACGGGTTCGACACTGTTAT
CAAAGCGAAGCAAGCTGTTGAAGCGAGTTGCCAGGGCGTCGTGTCATGCGCGGACATCTTAGCCATAGCTGCTCGAGACGTAGTTGTCCTG
GTAAGCAAGAACCTCTGTGGACAGTTCAC
CCTCGCAGCTCAATGTCGAGTCAAATGACTGTCATGCTCCAAGTCTTAACGTTTTCTCACTCGTTCAATGTGCATGAAAAATCTCAGGCCGGAGGTCCATCGTTCAACGTCGAGCTCGGC
CGTCGCGACGGTCTCATCTCCAAAGCATCTCTAGTAGCCGGGAAGTTACCGGAACCGAACTTCGATCTCGACCAGCTCAACGCGATTTTCTCCCAACACAACCTCACGCAATCTGACATG
ATCGCCCTCTCGGGCGCTCACACCCTCGGCTTCTCCCACTGCGACCGCTTCGCCAACCGTCTCTACTCGTTCTCCTCATCATCTCCGGTGGACCCGACTCTCAACTCGACCTACGCNGTG
CAGCTGATGCAAGAATGCCCCCAGAATGTGGACCCGCAAATAGCAATCAACATGGACCCCGTGACTCCGCGGACGTTCGACAACATGTACTACACGAATCTGGTCCAAGGCAAGGGCCTG
TTCACTTCGGACGAGNCGCTCTTCACCGATTCAGCGTCCAAGCCTACCGTGCTGAACTTCGCTAACAGCCCAGGCAGCTTCAACCGGGCCTTCGCCACCGCNATGAGGAAGCTCGGGAGG
GTGGGCATCAAGACCGGAAGCCAAGGAGAGATACGAAGAGATTGTACAGCTTTCAATTCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGAAACTAGGACTTTGGTTGGTGGTGGTTTTTGCGGTGGCGGCCACGGCGGAGGTGGGAAGAGCGCAACTGACGGAGGGTTTCTATGGCCAGACCTGCCCAAACGTCGAGAGC
ATCGTGAAGCAGGCGGTAACGACCAAGTTCGGCCAGACCTTCGTCACCATCCCCGGCACGCTCCGCCTCTTCTTCCACGATTGCTTCATCGAG
GGATGCGATGCTTCGATTTTGATCTCG
TCGCCTAATGGGGATGCTGAGAAAGACGCGCCGGATAATCAGTCTCTAGCCGGAGACGGGTTCGACACTGTTATCAAAGCGAAGCAAGCTGTTGAAGCGAGTTGCCAGGGCGTCGTGTCA
TGCGCGGACATCTTAGCCATAGCTGCTCGAGACGTAGTTGTCCTG
GCCGGAGGTCCATCGTTCAACGTCGAGCTCGGCCGTCGCGACGGTCTCATCTCCAAAGCATCTCTAGTAGCCGGG
AAGTTACCGGAACCGAACTTCGATCTCGACCAGCTCAACGCGATTTTCTCCCAACACAACCTCACGCAATCTGACATGATCGCCCTCTCGGGCGCTCACACCCTCGGCTTCTCCCACTGC
GACCGCTTCGCCAACCGTCTCTACTCGTTCTCCTCATCATCTCCGGTGGACCCGACTCTCAACTCGACCTACGCNGTGCAGCTGATGCAAGAATGCCCCCAGAATGTGGACCCGCAAATA
GCAATCAACATGGACCCCGTGACTCCGCGGACGTTCGACAACATGTACTACACGAATCTGGTCCAAGGCAAGGGCCTGTTCACTTCGGACGAGNCGCTCTTCACCGATTCAGCGTCCAAG
CCTACCGTGCTGAACTTCGCTAACAGCCCAGGCAGCTTCAACCGGGCCTTCGCCACCGCNATGAGGAAGCTCGGGAGGGTGGGCATCAAGACCGGAAGCCAAGGAGAGATACGAAGAGAT
TGTACAGCTTTCAATTCA

Retrieve as FASTA