Entry information : EguPrx157
Entry ID 11465
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx157
Name EguPrx157
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx157
start..stop
S start..stop
EglPrx157 668 0 1..331 1..331
EgrPrx157 666 0 1..331 1..331
EcamPrx157 664 0 1..331 1..331
CclPrx35 516 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10160..10384 225 N° 2 10755..10946 192 N° 3 11035..11200 166 N° 4 11571..11980 410
join(10160..10384,10755..10946,11035..11200,11571..11980)


exon

Literature and cross-references EguPrx157
Protein sequence: EguPrx157
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   35911.02 (33505.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.88 (7.69) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MXRSMTFLILFSILALAPMCYCXRTYGGYLYPQYYDYSCPQAEDIVXSVVAKAVAKEARMAASLLRVHFHDCFVQGCDGSILLDSTGTMPSEKXSNPNRKSARGFEVIEEIKAALEEQCPHTVSCADILALAARDSTVLMGGRSWEVPLGRKDSRGASLTLSNLNIPAPNDTFPILLNKFNRQGLDIIDLVTLSGSHTIGNARCTAFRQRLYDQSGDDQPDSRLDQSYXSQLRATCPRSGGDQNLFVLDNVTPTXFDNSYFKNLLAYRGLLSSDQVLFTSNKESIELVKKYAKDNEVFLQQFAASMVKMGNILPSTGSRGEIRKICRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_10_34970 (10160..11980)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGNCTCGGTCTATGACTTTTCTCATTCTCTTCTCAATCCTTGCACTTGCTCCAATGTGTTACTGTNGCAGAACCTATGGCGGTTACCTGTATCCCCAGTATTATGACTATTCATGCCCG
CAAGCTGAGGATATCGTCANGTCNGTTGTGGCAAAAGCTGTAGCCAAAGAAGCTCGCATGGCTGCTTCCTTGCTACGGGTTCACTTCCACGACTGTTTTGTTCAG
GTCAGTGACCTGTTA
ATTTTTTCAGCTGCACAGTCNCGTTTCATGTTAAAATGTACTGGTTAGGTGTACACAGTTGCATACATTTCAGTTGCAGTGCTTTGTNCATCTTTAGTTGCGTACACTATGTGGACACAG
CTGCACATTTACTTGACAGTCAACAGAAGCTGAAGCAAAGGGCTTAAATGAAGAGATACCATGTTCACAAATGTGCAAACATTATGGGTTGTATTCAACTGAAAATTGTCCGGGTAATTT
GTGCCAAACAGAGTCTCTACCGTATTAGTTTCCCTAAAATAGGACACCGCCTCTGTTATGTTGCAGACAAGAGTTAGTTTTTCATCTCTAAATCCCTTTTTCTGCAAACTTTCAGGGATG
TGATGGATCGATACTCTTAGACAGCACCGGAACCATGCCCAGTGAGAAAAGNTCTAACCCGAATCGTAAGTCCGCTCGGGGATTCGAAGTCATTGAGGAAATAAAGGCTGCCCTAGAAGA
GCAGTGCCCGCATACTGTGTCCTGTGCTGATATACTTGCTTTAGCTGCCAGAGACTCCACTGTTCTT
GTGAGTGATTTGCTTAATTAGGCTTTCCTAAACTTTAAAGTGAAGTCATGGGT
TGAATCGTTAATAACTTACATTTTGTTCTCTTCAGATGGGTGGACGTAGCTGGGAGGTTCCTCTAGGAAGAAAGGACTCGAGGGGTGCAAGTTTAACTCTTTCTAACCTCAACATCCCTG
CACCAAATGACACTTTCCCNATCCTCCTGAACAAATTCAATCGCCAGGGGCTCGATATTATTGATCTCGTCACATTATCAG
GTAAGATACGACTCTAACCTATAACGATCTACTCTTGCC
TCTGGGTAGAATCGTGAAGCCTCTTCTATCTGACGTTTCCTACAAAAGGAAAACTTCCTATATGATGCAGCAATTTTCTTGTTGACCGGGTTGAATGAATTCAGGTTTTTCAAAACAAAA
GAGCTCCTAATGCATTATCATTGCTTCGTTCAAATAACNCTTAATCGAGNGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGTGGGTTTCATGAAATCACTGGCAAATTTCATAT
GATAATCTGCTAGTGTCAGCAACAGTTTAAGCATTCAGAGTCATGTAATGCAAGTGTGGGGGTCTGGTACATGATTTTTCTCCCTGTACAGGAAGCCACACCATTGGCAATGCGAGATGC
ACCGCGTTTAGACAAAGGCTCTACGACCAGTCAGGGGACGATCAACCGGACTCCAGACTAGACCAGTCATACGNTTCCCAACTCCGTGCCACTTGCCCGAGATCGGGCGGTGATCAGAAC
CTGTTCGTCTTGGACAATGTCACTCCGACTGNGTTCGATAACAGCTACTTCAAGAATTTGCTGGCTTACAGGGGCCTGCTGAGCTCTGACCAAGTGCTCTTCACTAGTAACAAGGAATCA
ATTGAGTTGGTGAAGAAATACGCAAAGGACAATGAAGTCTTCTTGCAGCAATTTGCAGCTTCAATGGTCAAGATGGGTAATATCTTGCCATCGACAGGATCGAGGGGTGAGATCAGGAAG
ATCTGCAGGAAGATCAACAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGNCTCGGTCTATGACTTTTCTCATTCTCTTCTCAATCCTTGCACTTGCTCCAATGTGTTACTGTNGCAGAACCTATGGCGGTTACCTGTATCCCCAGTATTATGACTATTCATGCCCG
CAAGCTGAGGATATCGTCANGTCNGTTGTGGCAAAAGCTGTAGCCAAAGAAGCTCGCATGGCTGCTTCCTTGCTACGGGTTCACTTCCACGACTGTTTTGTTCAG
GGATGTGATGGATCG
ATACTCTTAGACAGCACCGGAACCATGCCCAGTGAGAAAAGNTCTAACCCGAATCGTAAGTCCGCTCGGGGATTCGAAGTCATTGAGGAAATAAAGGCTGCCCTAGAAGAGCAGTGCCCG
CATACTGTGTCCTGTGCTGATATACTTGCTTTAGCTGCCAGAGACTCCACTGTTCTT
ATGGGTGGACGTAGCTGGGAGGTTCCTCTAGGAAGAAAGGACTCGAGGGGTGCAAGTTTAACT
CTTTCTAACCTCAACATCCCTGCACCAAATGACACTTTCCCNATCCTCCTGAACAAATTCAATCGCCAGGGGCTCGATATTATTGATCTCGTCACATTATCAG
GAAGCCACACCATTGGC
AATGCGAGATGCACCGCGTTTAGACAAAGGCTCTACGACCAGTCAGGGGACGATCAACCGGACTCCAGACTAGACCAGTCATACGNTTCCCAACTCCGTGCCACTTGCCCGAGATCGGGC
GGTGATCAGAACCTGTTCGTCTTGGACAATGTCACTCCGACTGNGTTCGATAACAGCTACTTCAAGAATTTGCTGGCTTACAGGGGCCTGCTGAGCTCTGACCAAGTGCTCTTCACTAGT
AACAAGGAATCAATTGAGTTGGTGAAGAAATACGCAAAGGACAATGAAGTCTTCTTGCAGCAATTTGCAGCTTCAATGGTCAAGATGGGTAATATCTTGCCATCGACAGGATCGAGGGGT
GAGATCAGGAAGATCTGCAGGAAGATCAACAGT

Retrieve as FASTA