Entry information : EguPrx158
Entry ID 11466
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx158
Name EguPrx158
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx158
start..stop
S start..stop
EglPrx158 633 0 1..316 1..316
EcamPrx158 627 0 1..316 1..316
EgrPrx158 627 0 1..316 1..316
PtPrx44 518 0 1..316 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6334..6537 204 N° 2 6045..6233 189 N° 3 5363..5525 163 N° 4 4838..5229 392
complement(join(4838..5229,5363..5525,6045..6233,6334..6537))


exon

Literature and cross-references EguPrx158
Protein sequence: EguPrx158
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   33160.86 (30899.6)  
PI (pH):   %s   8.93 (8.93) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIVVALFSSLLVLSFVSPISSLXSNYYDKTCPNAELIVANAVKNAAMKDKTVPAALLRMHFXDCFXRGCDASVLLNSKGSNKAEKDGPPNVSLHSFFVIDNAKKELEASCPGVVSCADILALAARDSVVLSGGPTWDVPKGRKDGRTSKASETTQLPAPLFNISQLQQSFSQRGLSMEDLVALSGGHTLGFSHCSSFAGRIRNFNTTHDIDPLMHPSLAAXLRGVCPSXNRPKNAGTTMDPSSTTFDNTYYRLILQGKGLFSSDQALLAVPKTKGLVEKFAGSHKEFTDAFVKSMIKMSSITGGGEVRKDCRVV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_10_35046 (6537..4838)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCGTTGTTGCACTCTTCAGCTCGCTTCTTGTACTTTCATTTGTCTCTCCAATCTCTTCACTAAGNTCCAATTACTACGACAAGACCTGTCCCAATGCTGAGTTGATCGTCGCA
AATGCTGTCAAGAATGCGGCAATGAAGGACAAAACCGTTCCGGCTGCTCTTCTGCGGATGCATTTTCANGACTGTTTCATNAGG
GTAAGCAAACGTGTCTGATAGTTCTCTATCTGTTTC
AGAGTTCTTACACAAAGCTTCCTTAGTTATCAGAACTCAACAGATAGTTCTCTATCTGTTTCAGGGTTGCGATGCGTCGGTGCTTTTAAACTCCAAAGGAAGCAACAAAGCGGAGAAGGA
TGGACCTCCTAATGTCTCTCTGCACTCATTTTTTGTAATCGACAATGCCAAAAAGGAGTTGGAAGCTTCTTGCCCCGGCGTGGTTTCATGTGCGGACATCTTGGCACTAGCTGCTAGAGA
TTCCGTCGTACTG
GTAAAATCTCTCCTCATCCACTTTGTTACGTGTATATCCCGATTCTTCACGACCAACCAATCCCTCCAGCATAGCTTGTCACTGAGATTGTCCTGAAAATCCACCCT
AAACCGTCTAAAACATAAACGCTGATGTCTTGGAAACATCTTAGGGCCAAGTGTAGGGATCCTGTCCAATCCTGAGCTTACTGCGCAATGTCCTGGACAGTCTTCACGCAGGTCTCTATC
CTGGAAAATAATAGAGAAACCAGGCAGGACGGTGTTAAGCTACCAACTCTTGGGAATGTCTGCTTGCACCGCAAGAATTTGGATAGATACATATTCACTCAATATGTGCATAAATAGGTT
TAAACAGGACCAAACGGAAGTCGGCCTACTGGAAGCTAAATCAATGCCCACTGAACAAATCCCTTCNCCCAGTAGNAATTTTAGCCGTAATTTCTCGACTAGAAGGTTCCCTTGTGCACA
GCATATTGCGTATCTCACTGAGATTTTCTTTCATTTCTGATGCGTAAAAAAGTCCGGAGGTCCGACTTGGGATGTGCCCAAGGGAAGGAAGGATGGAAGAACATCAAAAGCCAGCGAGAC
GACACAACTCCCAGCACCACTTTTCAACATTTCTCAGCTCCAGCAGAGCTTCTCCCAGAGAGGCCTCTCTATGGAAGATCTCGTCGCTCTTTCGG
GTATANCAAATAATCAAACGGACCA
ATATATGACGGTGTTTTGTCGAGAAATTCACTCTGCCAGATTCATTCATTTGTTTTGGTTTTTCACCTGTGCTGATTCTGATCTCAACTTCTATCCCTCCCCTTGCAGGAGGCCACACAC
TAGGATTTTCCCACTGCTCCTCCTTCGCAGGCAGGATCCGCAACTTCAACACCACGCACGACATCGACCCATTGATGCACCCATCCCTGGCAGCNANCCTAAGAGGCGTGTGCCCGAGCA
ANAACAGGCCAAAAAACGCAGGGACCACCATGGACCCTTCCTCGACCACCTTCGACAACACGTACTACAGGCTGATCCTCCAGGGGAAGGGCCTGTTCTCTTCGGACCAGGCCCTCCTGG
CAGTGCCCAAGACGAAGGGTCTGGTCGAGAAGTTCGCAGGCTCGCACAAGGAATTCACGGATGCATTCGTCAAGTCCATGATCAAGATGAGCAGCATCACAGGCGGAGGGGAAGTTAGGA
AGGACTGCAGGGTAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCGTTGTTGCACTCTTCAGCTCGCTTCTTGTACTTTCATTTGTCTCTCCAATCTCTTCACTAAGNTCCAATTACTACGACAAGACCTGTCCCAATGCTGAGTTGATCGTCGCA
AATGCTGTCAAGAATGCGGCAATGAAGGACAAAACCGTTCCGGCTGCTCTTCTGCGGATGCATTTTCANGACTGTTTCATNAGG
GGTTGCGATGCGTCGGTGCTTTTAAACTCCAAAGGA
AGCAACAAAGCGGAGAAGGATGGACCTCCTAATGTCTCTCTGCACTCATTTTTTGTAATCGACAATGCCAAAAAGGAGTTGGAAGCTTCTTGCCCCGGCGTGGTTTCATGTGCGGACATC
TTGGCACTAGCTGCTAGAGATTCCGTCGTACTG
TCCGGAGGTCCGACTTGGGATGTGCCCAAGGGAAGGAAGGATGGAAGAACATCAAAAGCCAGCGAGACGACACAACTCCCAGCACCA
CTTTTCAACATTTCTCAGCTCCAGCAGAGCTTCTCCCAGAGAGGCCTCTCTATGGAAGATCTCGTCGCTCTTTCGG
GAGGCCACACACTAGGATTTTCCCACTGCTCCTCCTTCGCAGGC
AGGATCCGCAACTTCAACACCACGCACGACATCGACCCATTGATGCACCCATCCCTGGCAGCNANCCTAAGAGGCGTGTGCCCGAGCAANAACAGGCCAAAAAACGCAGGGACCACCATG
GACCCTTCCTCGACCACCTTCGACAACACGTACTACAGGCTGATCCTCCAGGGGAAGGGCCTGTTCTCTTCGGACCAGGCCCTCCTGGCAGTGCCCAAGACGAAGGGTCTGGTCGAGAAG
TTCGCAGGCTCGCACAAGGAATTCACGGATGCATTCGTCAAGTCCATGATCAAGATGAGCAGCATCACAGGCGGAGGGGAAGTTAGGAAGGACTGCAGGGTAGTCAAT

Retrieve as FASTA