Entry information : OsPrx137
Entry ID 1147
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette)
Peroxidase information: OsPrx137
Name OsPrx137
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx137
start..stop
S start..stop
SbPrx106 525 0 25..327 37..341
ZmPrx130 521 0 10..327 16..334
SiPrx53 518 0 19..327 22..331
ZmPrx131 480 2e-172 19..325 27..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4653353..4653565 213 N° 2 4653051..4653236 186 N° 3 4652802..4652964 163 N° 4 4652293..4652714 422
complement(join(4652293..4652714,4652802..4652964,4653051..4653236,4653353..4653 565))


exon

Literature and cross-references OsPrx137
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1F6
DNA ref. GenBank:   NC_008405.1 (4653565..4652296)
Protein sequence: OsPrx137
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   34441.24 (31964.0)  
PI (pH):   %s   4.59 (4.57) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAILASMAAMAFLLLMEAMSVSHGQLQVGFYSDSCPDAEDIVTAAVQDAAGSDPTILPALLRLQFHDCFVRGCDASVLIRSARNDAEVNNNKHQGLRGQAVVDAAKAELEDQCPGVVSCADIIALAARDAIAMTGGPSFDVPTGRRDGLVSNLRDADVLPDVVDSIQVLRSRFAASGLDDRDLVLLTAAHTIGTTACFFVKDRLYNYRLRGGGVGSDPSIPAAFLAELKARCAPGDFNTRVALDRGSERDFDDSILRNIRSGLAVIASDAALDASNATRGLVTAYLGAASRRFERDFVAAMVKMGTIGALTGDDGEVRDVCSQFNTD

Retrieve as FASTA  
Remarks chromosome 12. 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCCTGGCGTCCATGGCGGCAATGGCGTTCTTGCTGCTGATGGAGGCAATGAGCGTGTCACACGGCCAGCTTCAGGTCGGGTTCTACTCCGACTCCTGCCCCGACGCTGAGGAC
ATCGTCACCGCCGCCGTCCAGGACGCCGCCGGCTCCGACCCCACCATCCTCCCCGCCCTCCTCCGCCTCCAGTTCCACGACTGCTTCGTCCGG
GTACGCGACGTCATTCTGTTTCGCGCT
CGGTGGCGCGCCAGCGCGCCGGCGATCGACGCGGCGTCTGACGGTGTTGCGGCGTGGCGTGGCGTGGCGTGGCGTGGCGTGGCGTGCAGGGGTGCGACGCGTCGGTGCTGATCCGGAGCG
CGCGGAACGACGCGGAGGTGAACAACAACAAGCACCAGGGGCTGCGCGGGCAGGCCGTCGTGGACGCGGCCAAGGCGGAGCTCGAGGACCAGTGCCCCGGCGTCGTCTCCTGCGCCGACA
TCATCGCGCTCGCCGCGCGCGACGCCATCGCCATG
GTAAGCATCGAGAACAGAGACTTTGTGTTCGACGCGCGCCACGAGATAGGTGTTTGATGCGTGTCTCGCCGTGTCATGTTCGTCA
GACGGGCGGGCCGTCGTTCGACGTGCCGACGGGGCGGCGCGACGGGCTGGTCTCCAACCTCCGCGACGCCGACGTGCTTCCGGACGTCGTCGATTCCATCCAGGTGCTCCGCTCCAGGTT
CGCCGCCAGCGGCCTCGACGACCGCGACCTCGTCCTCCTCACAG
GTACGCGCCGACACTGACACTGACAATCCGTCCATGGCTTCACCACCTCCATTGACACGATCAATGGCGTCGCCAC
CGCCAATGCAGCGGCGCACACGATCGGCACGACGGCGTGCTTCTTCGTGAAGGACAGGCTGTACAACTACCGCCTCCGCGGCGGCGGCGTCGGGTCGGACCCGTCCATCCCGGCGGCGTT
CCTGGCGGAGCTCAAGGCGCGGTGCGCGCCGGGCGACTTCAACACGCGCGTCGCGCTGGACCGCGGCAGCGAGCGCGACTTCGACGACTCCATCCTCCGCAACATCCGCTCCGGCCTCGC
CGTCATCGCCTCTGACGCCGCGCTCGACGCCAGCAACGCCACGCGCGGCCTCGTCACGGCCTACCTCGGCGCCGCGTCGCGCAGGTTCGAGCGGGACTTCGTCGCCGCCATGGTGAAGAT
GGGCACCATCGGCGCGCTCACCGGCGACGACGGCGAGGTCAGGGACGTGTGCTCCCAGTTCAACACCGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCCTGGCGTCCATGGCGGCAATGGCGTTCTTGCTGCTGATGGAGGCAATGAGCGTGTCACACGGCCAGCTTCAGGTCGGGTTCTACTCCGACTCCTGCCCCGACGCTGAGGAC
ATCGTCACCGCCGCCGTCCAGGACGCCGCCGGCTCCGACCCCACCATCCTCCCCGCCCTCCTCCGCCTCCAGTTCCACGACTGCTTCGTCCGG
GGGTGCGACGCGTCGGTGCTGATCCGG
AGCGCGCGGAACGACGCGGAGGTGAACAACAACAAGCACCAGGGGCTGCGCGGGCAGGCCGTCGTGGACGCGGCCAAGGCGGAGCTCGAGGACCAGTGCCCCGGCGTCGTCTCCTGCGCC
GACATCATCGCGCTCGCCGCGCGCGACGCCATCGCCATG
ACGGGCGGGCCGTCGTTCGACGTGCCGACGGGGCGGCGCGACGGGCTGGTCTCCAACCTCCGCGACGCCGACGTGCTTCCG
GACGTCGTCGATTCCATCCAGGTGCTCCGCTCCAGGTTCGCCGCCAGCGGCCTCGACGACCGCGACCTCGTCCTCCTCACAG
CGGCGCACACGATCGGCACGACGGCGTGCTTCTTCGTG
AAGGACAGGCTGTACAACTACCGCCTCCGCGGCGGCGGCGTCGGGTCGGACCCGTCCATCCCGGCGGCGTTCCTGGCGGAGCTCAAGGCGCGGTGCGCGCCGGGCGACTTCAACACGCGC
GTCGCGCTGGACCGCGGCAGCGAGCGCGACTTCGACGACTCCATCCTCCGCAACATCCGCTCCGGCCTCGCCGTCATCGCCTCTGACGCCGCGCTCGACGCCAGCAACGCCACGCGCGGC
CTCGTCACGGCCTACCTCGGCGCCGCGTCGCGCAGGTTCGAGCGGGACTTCGTCGCCGCCATGGTGAAGATGGGCACCATCGGCGCGCTCACCGGCGACGACGGCGAGGTCAGGGACGTG
TGCTCCCAGTTCAACACCGACTGA

Retrieve as FASTA