Entry information : EguPrx167
Entry ID 11471
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-24 (Christophe Dunand)
Peroxidase information: EguPrx167
Name EguPrx167
Class Class III peroxidase    [Orthogroup: Prx101]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx167
start..stop
S start..stop
EgrPrx167 642 0 1..320 1..320
EcamPrx200 540 0 1..320 1..320
EgrPrx169 538 0 1..320 1..320
EcamPrx188 521 0 1..320 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 41995..42213 219 N° 2 42874..43065 192 N° 3 43197..43745 549  
join(41995..42213,42874..43065,43197..43745)


exon

Literature and cross-references EguPrx167
Protein sequence: EguPrx167
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (295)
PWM (Da):   %s   33389.53 (30731.1)  
PI (pH):   %s   6.87 (6.50) Peptide Signal:   %s   cut: 26 range:26-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFDTALKISFLFVVCVITSRSASAQLSNQNYYEKGCPKALQTIGSAVKSAVANESRMGASLLRLHFHDCFVNGCDGSILLDDTANFTGEKTAFPNLNSLRGFDVVDTIKSEVEKLCPGVVSCADILAIVARDSVVELGGQSWQVQLGRRDSTTASLNTANTDLPAPTLNLSALITSFSNKGFTAEEMVTLSGSHTIGQSRCVTFRARLYNESNIDSSFATTLKANCPSSGGDNXLSPLDVTSPTSFDNAYFTNLVXQXGLLHSDQQLXSGGSTNAQVTAYSKNFGSFXNDFAKAMVKMGGLSPLTGSTGQIRTNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
scaffold_11_36684 (41995..43745)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGATACAGCCCTGAAAATCAGCTTCCTTTTCGTTGTTTGCGTGATCACGTCGAGATCTGCCTCGGCACAGTTGTCTAACCAAAATTACTACGAGAAAGGGTGCCCGAAAGCA
CTCCAGACCATTGGATCTGCCGTGAAATCGGCAGTGGCCAATGAGTCCCGCATGGGAGCATCCTTGCTCCGTCTTCACTTCCATGATTGCTTCGTCAAT
GCAAGTCTCATTCGCTTTCTC
ACTCTGCTCTATGTTTTTCACTTCCACGTCCATTTTCATTCTTTTGTGCATGTGTTGCATGTTCTTTTATGTGCGAGCTTTTACTTCATTCCCGATCCATACATGGATTATTCCTTTATG
TGTATTTTCGATTGATCATCCATTCCTGCTTCGCTAAAAACAATTTTNACGTCCGATGTTAGAAGAGTTGCAAAACAACATTGTTTTTTTTTCCTTCATCTTTTTCCATTTTATTATCTT
GCGTTGGTTATATAATTCCACGCATGTCACACACATCAGTGAGTACAACCCGTTTAGTAGGAAAAGATGTGACCAACATTTTGGAAATTCGAATTTTTAAGGAATACTGCAACAACTGAG
ATACAAGGGCCAACGATTCCATTAAATTAAGAAAGAACNGACATTGAGCTGACCATAGCACACCCCTGCCAACCTGGTGTCTCTAACTTCGTCTTTTCTCCCCCTTTTTTTTTTAAGGAA
ACGTCTCTCTTTTAACATTCCTTTCCGATTGTTCGTAAGGGAAAAAACACTATTTTGTTTCCTCATAAATTCAATATTTAGATCATCCTTTCTGCTTCGTTGGATCTTGTAAACCTAATA
AGATGAAATATTGATGTTCTTTTTAATTTTTTTTTACAGGGTTGTGATGGATCAATTCTACTAGATGACACCGCGAACTTTACTGGGGAGAAGACGGCGTTTCCCAACTTGAACTCCTTG
AGGGGATTCGATGTGGTTGACACCATCAAGTCAGAAGTGGAAAAACTGTGCCCTGGCGTCGTCTCGTGCGCTGACATCTTAGCCATTGTTGCGAGAGATTCCGTNGTCGAA
GTAAGCACC
CAACTCTTGAGATTTCTTAGAANGTAATTTTATTATTAATNTCTCAGAATATTCTTTTGAATTGATANGAAGAAAATTTGAGTTTCCTAATCTTACGTGGATTCATTGAATTTGATTTTC
AGTTGGGGGGACAGAGTTGGCAAGTTCAACTAGGAAGAAGAGATTCAACCACGGCGAGCCTGAACACTGCTAATACTGACCTCCCAGCTCCAACTCTTAATCTTAGTGCCCTAATCACTT
CTTTCTCTAACAAAGGCTTCACTGCCGAAGAAATGGTAACCCTCTCAGGATCTCACACCATAGGCCAATCCAGGTGCGTGACNTTCCGGGCCCGTCTTTACAACGAAAGCAACATAGACT
CGTCGTTCGCCACAACTTTAAAAGCCAATTGCCCTAGCTCGGGAGGTGACAACAANCTCTCCCCTCTTGACGTCACCAGCCCGACGTCCTTCGACAATGCCTACTTCACCAACTTGGTGN
GCCAAAANGGTTTGCTTCATTCGGACCAGCAATTGTTNAGTGGAGGTTCGACGAATGCTCAAGTGACTGCCTACAGCAAGAACTTTGGCTCGTTCCANAATGATTTTGCCAAGGCCATGG
TCAAGATGGGTGGCCTTAGCCCTCTCACCGGGTCCACTGGTCAAATCAGGACGAATTGTAGAAGAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGATACAGCCCTGAAAATCAGCTTCCTTTTCGTTGTTTGCGTGATCACGTCGAGATCTGCCTCGGCACAGTTGTCTAACCAAAATTACTACGAGAAAGGGTGCCCGAAAGCA
CTCCAGACCATTGGATCTGCCGTGAAATCGGCAGTGGCCAATGAGTCCCGCATGGGAGCATCCTTGCTCCGTCTTCACTTCCATGATTGCTTCGTCAAT
GGTTGTGATGGATCAATTCTA
CTAGATGACACCGCGAACTTTACTGGGGAGAAGACGGCGTTTCCCAACTTGAACTCCTTGAGGGGATTCGATGTGGTTGACACCATCAAGTCAGAAGTGGAAAAACTGTGCCCTGGCGTC
GTCTCGTGCGCTGACATCTTAGCCATTGTTGCGAGAGATTCCGTNGTCGAA
TTGGGGGGACAGAGTTGGCAAGTTCAACTAGGAAGAAGAGATTCAACCACGGCGAGCCTGAACACTGCT
AATACTGACCTCCCAGCTCCAACTCTTAATCTTAGTGCCCTAATCACTTCTTTCTCTAACAAAGGCTTCACTGCCGAAGAAATGGTAACCCTCTCAGGATCTCACACCATAGGCCAATCC
AGGTGCGTGACNTTCCGGGCCCGTCTTTACAACGAAAGCAACATAGACTCGTCGTTCGCCACAACTTTAAAAGCCAATTGCCCTAGCTCGGGAGGTGACAACAANCTCTCCCCTCTTGAC
GTCACCAGCCCGACGTCCTTCGACAATGCCTACTTCACCAACTTGGTGNGCCAAAANGGTTTGCTTCATTCGGACCAGCAATTGTTNAGTGGAGGTTCGACGAATGCTCAAGTGACTGCC
TACAGCAAGAACTTTGGCTCGTTCCANAATGATTTTGCCAAGGCCATGGTCAAGATGGGTGGCCTTAGCCCTCTCACCGGGTCCACTGGTCAAATCAGGACGAATTGTAGAAGAGTCAAT

Retrieve as FASTA