Entry information : EguPrx169
Entry ID 11473
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx169
Name EguPrx169
Class Class III peroxidase     [Orthogroup: Prx074]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx169
start..stop
S start..stop
EcamPrx169 589 0 1..300 40..339
EglPrx169 585 0 1..300 40..339
EgrPrx169 485 4e-175 53..300 73..320
EcamPrx200 471 1e-169 53..300 73..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3719..3877 159 N° 2 4256..4447 192 N° 3 4537..5085 549  
join(3719..3877,4256..4447,4537..5085)


exon

Literature and cross-references EguPrx169
Protein sequence: EguPrx169
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   300
PWM (Da):   %s   32160.91 Transmb domain:   %s   o10-32i
PI (pH):   %s   7.37
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ASPFRFLAQFYPFSFMSSFVYVLHVLLRANFYFIPNPYKDYSSSTFIFDGSSHGCDASILLDDTVNFTGEKTAFPNVNSVRGFDVIDTIKLKVEKLCPGVVSCXDILAVAARDSVVILDGPSWQVQLGRRDSTTASLNDANIXLPAPTLNLSGLVTSFFNKGFTAKEMVTLSGSHTIGQARCMTFRTRLYNESNISPSFAMSLKSNCPSSXGDNNLSPLDITSPTFFDNAYFSNLVSQEGLLHSDQQLFSGGSTNAQVAAYSKNLGSFRNDFADAMVKMGGLSPLTGSSGQIRTNCRKVN

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' end is missing). Scaffold_11_36686 (3719..5085)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAAGTCCCTTCCGCTTTCTCGCTCAGTTCTATCCTTTTTCCTTCATGTCCAGTTTCGTGTATGTTTTGCATGTTCTTTTACGTGCAAACTTTTACTTCATTCCCAATCCATATAAGGAT
TACTCTTCCTCCACGTTTATTTTCGATGGTTCCTCGCAT
GTCTGCTTAATTCACTCCTGATTGAAAATGGCCAACATTTTGGAGATTCGGATCTTTGAGGAATATTGCAACAAGTGAGCT
ACGTGGGCCAATGATTCCATTNAATTAAGAAAGAACACGCATTGAGCTGATCATAGCACACCATTTAGACGACCTGCCAATCTTGTGTCTCTAACTATGTCTTTTTTTCATGCAATATAT
ATTTGTCTCCATATCTTATTCTATTCTAACCGATGAATTGTCTCTCTTAACGTTCCTTTCCGGTTGCTTGCAAAAAAAAAAAAATTATTTTGTTTCCTCACAGGTTCAATATTTAGATCA
TCCTTTCTAGTTCGTTAGATCTTCTAAACTTAATAAGATTTTTTTTTTTTTTGATAGGGATGTGATGCATCCATTCTACTAGATGACACCGTGAACTTCACTGGGGAGAAGACAGCGTTT
CCCAACGTGAACTCCGTGAGGGGATTCGATGTGATTGACACCATCAAGTTAAAAGTGGAGAAACTGTGTCCTGGCGTTGTCTCGTGCNCTGACATCTTAGCCGTTGCTGCTAGGGACTCC
GTTGTCATT
GTAAGCATTGATACTTGAAATTTCTTTAAACATACAAAGAAACTATTATTTTCCTAAACTTATGTGGATTCAATTAATTTGATGTTTAGTTGGATGGACCGAGTTGGCAAG
TCCAACTGGGAAGAAGAGACTCAACCACAGCGAGCCTAAATGATGCTAATATCNACCTCCCAGCTCCAACTCTTAATCTCAGTGGTCTCGTCACCTCTTTCTTTAACAAAGGCTTTACTG
CCAAAGAAATGGTAACACTATCAGGATCCCACACCATAGGCCAGGCTAGGTGCATGACGTTTCGGACCCGACTCTACAACGAGAGCAATATAAGCCCGTCATTCGCCATGTCTTTAAAGT
CTAATTGCCCCAGCTCTGNAGGCGACAACAACCTATCCCCTCTCGACATCACAAGCCCGACGTTCTTTGACAATGCCTACTTCAGCAACTTGGTGAGCCAAGAGGGCCTGCTTCATTCGG
ATCAACAGTTGTTTAGTGGAGGTTCGACNAATGCTCAAGTGGCTGCCTACAGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGCCTTAGTCCTC
TTACCGGGTCTAGCGGTCAGATCAGGACCAATTGCAGAAAAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAAGTCCCTTCCGCTTTCTCGCTCAGTTCTATCCTTTTTCCTTCATGTCCAGTTTCGTGTATGTTTTGCATGTTCTTTTACGTGCAAACTTTTACTTCATTCCCAATCCATATAAGGAT
TACTCTTCCTCCACGTTTATTTTCGATGGTTCCTCGCAT
GGATGTGATGCATCCATTCTACTAGATGACACCGTGAACTTCACTGGGGAGAAGACAGCGTTTCCCAACGTGAACTCCGTG
AGGGGATTCGATGTGATTGACACCATCAAGTTAAAAGTGGAGAAACTGTGTCCTGGCGTTGTCTCGTGCNCTGACATCTTAGCCGTTGCTGCTAGGGACTCCGTTGTCATT
TTGGATGGA
CCGAGTTGGCAAGTCCAACTGGGAAGAAGAGACTCAACCACAGCGAGCCTAAATGATGCTAATATCNACCTCCCAGCTCCAACTCTTAATCTCAGTGGTCTCGTCACCTCTTTCTTTAAC
AAAGGCTTTACTGCCAAAGAAATGGTAACACTATCAGGATCCCACACCATAGGCCAGGCTAGGTGCATGACGTTTCGGACCCGACTCTACAACGAGAGCAATATAAGCCCGTCATTCGCC
ATGTCTTTAAAGTCTAATTGCCCCAGCTCTGNAGGCGACAACAACCTATCCCCTCTCGACATCACAAGCCCGACGTTCTTTGACAATGCCTACTTCAGCAACTTGGTGAGCCAAGAGGGC
CTGCTTCATTCGGATCAACAGTTGTTTAGTGGAGGTTCGACNAATGCTCAAGTGGCTGCCTACAGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGA
GGCCTTAGTCCTCTTACCGGGTCTAGCGGTCAGATCAGGACCAATTGCAGAAAAGTCAAT

Retrieve as FASTA