Entry information : EguPrx17
Entry ID 11474
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx17
Name EguPrx17
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx17
start..stop
S start..stop
EgrPrx20 631 0 1..319 1..319
EgrPrx18 614 0 1..319 1..319
EcamPrx20 608 0 1..319 1..319
EgrPrx17 599 0 1..319 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15083..15298 216 N° 2 16416..16607 192 N° 3 16728..16893 166 N° 4 17016..17398 383
join(15083..15298,16416..16607,16728..16893,17016..17398)


exon

Literature and cross-references EguPrx17
Protein sequence: EguPrx17
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   33346.43  
PI (pH):   %s   7.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACESSSTRPAFLLLLCFLHGTASAQLSSTFYSTYCPSALSTIKSSVSSAVKNEARMGASLLRLHFHDCFVNGCDASILLDDTTNFTXEKNAGPNANSMRGFEVXDTXKSELESKCPSIVSCADILAVVARDSIVALGGPSWTVNLGRRDSTTASQSAANISIPPPTLNLSGLIXTFSNKGFTAKEMVALLGSHTIGQARCLTFREHLYNENNIDATFATSLKANCPSSGGDSKLFPFDTTSPTSFDNAFFKNLQTXKVFLHSDQQLFSXGSTDVHVNAYSSNLSTFRTDFANAMVKMGNLSPLIGSSXQIRKNCRKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_1_733 (15083..17398)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCCACCAGACCAGCCTTCTTATTGTTGCTGTGTTTCCTCCATGGAACAGCCTCTGCTCAGCTGTCCAGTACTTTCTACTCCACTTACTGTCCCAGCGCCCTC
TCCACCATCAAATCCAGCGTGAGCTCTGCGGTCAAAAACGAGGCCCGCATGGGCGCGTCCTTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GCAAGTCCCTCTGCTCTGAGTCTC
TCCTCTCTTTCCGATTGATTACTACCATTGTTTCTCTCCTTCATTCAAGCTGAATGCAAGCGAGCATGCATGATGCATCTTTGTGCCTACGCATGTGAAGCGTTCCATCCAACCACATAG
TCAAAAGAATCATTAGATTCGCTTCTACGCAAGTNACGTACTCTCTTTTTCACTAACCAAACAGTAGNTAGGAGGTTGACATATTGAATTAGTTGAGATTTTTGGTGCTTTGTTGTGTCA
TGCATTTTTGTGAGTTTATTATACCAATAATCAATTCTGTTTATTAGAGCACAATAATTTTTTTGNTAATTTGAAAAAACTTCATGATTATTTTTAGCATACATTGCCGGTGTAAAAATA
TTTTTCACAAACAATCTTATCCACCCTTAATTTGGCNGTTAGTGAGAGATTTGGTAATTAGAANCCTCAAATTACGAATGGNCAAGAATGATTATGTAAAATTTTNTTTACATNGATGGT
CTATGCTCTAATTTNCACNGGANAAAACTANGCAGGAGAGCGTNCTTTACGNTAACTATGCTGTTGATCAGATAAATGGGTATATAAATAACATTGGAGCNGGCAAAAAGAGAGAGATGG
CCATTGCTTNTTATATCGGCGNTTGACTTTACTCGGTTATCACATTTGGCTAACCAATCAGTCCTTCTCAATAGATTTTGATCATANTTTGATCACCTCNCTGTGGTAGCCATACATTTC
TACATAAAAAGTGATATGGATGGTAAAGTACCGTTTTTAATGAAATTTGATAACTCAATACTATTCTAAAATCGCNNTAGATCTTTGAACAAGCAAATCGTGCCTTTTGCATGGCCTCAT
TAGTTTGCTTNCACACAAATTCAAAGTNTCAATATAAATTAAGTAATCGATTTAGATTAGTANGTTCATAATGGGGGGGGGGGGGGGCAAACTATTTCAGTAAAGATTATAGCACTTAAC
TTGTTTTTTTTTTTTTTTGGGTAAGGTATAGCACTTAACTTGTTTGCAACCATTAAATCTAATTAANTCCAATCGGATCAATTTTCTATCTAGAAGGACTGATTAACAACATGTGGCAAA
AAACATGAAATAGGGATGCGACGCGTCAATCTTATTGGACGACACTACGAACTTTACCNGGGAGAAGAACGCCGGCCCGAATGCCAATTCCATGCGGGGATTTGAGGTAATNGACACANT
CAAGTCCGAATTGGAGAGCAAGTGCCCCAGTATTGTGTCCTGCGCTGATATTTTAGCCGTCGTTGCACGAGACTCCATCGTTGCC
GTAAGTGCACATTTTCTTCTCAATTGTACTTATCA
ATTGTGATGAAAAAAATCACATGTTATGTTCCCCATGCTATATTAATACTAACACGTATNGATTTGTTATTTATTTAATTTTTAGTTAGGTGGCCCTAGTTGGACAGTCAACCTTGGAAG
AAGAGACTCAACCACTGCAAGTCAAAGTGCTGCTAATATTAGCATTCCTCCCCCAACTTTGAACCTTAGCGGCCTAATCTNTACCTTCTCTAACAAAGGCTTCACAGCTAAAGAAATGGT
GGCACTTTTAG
GTCATTGTTTCTTTCTTCTTCTTTTTCTCTTTTTTTTTTGCAATATTTAATAAAGAATAACAATAATGCTCGATCAATATACTAAAATCAATTTACAAAAATTGTTCGA
CCATTGTTAACAGGGTCGCACACTATAGGTCAAGCCCGATGCCTGACTTTCCGGGAGCATCTTTACAATGAGAACAACATCGATGCCACGTTCGCGACATCGCTGAAAGCAAATTGCCCA
AGCTCCGGAGGCGACAGCAAACTCTTTCCTTTTGACACCACAAGCCCGACGTCCTTTGACAACGCCTTCTTCAAGAACTTGCAAACCNACAAGGTTTTTCTTCATTCGGACCAGCAATTG
TTCAGTGNTGGCTCCACGGACGTTCACGTGAATGCTTATAGTAGCAATTTGTCCACTTTTAGGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTTAGCCCACTCATTGGCTCA
AGCNGTCAGATTAGAAAGAATTGCAGGAAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCCACCAGACCAGCCTTCTTATTGTTGCTGTGTTTCCTCCATGGAACAGCCTCTGCTCAGCTGTCCAGTACTTTCTACTCCACTTACTGTCCCAGCGCCCTC
TCCACCATCAAATCCAGCGTGAGCTCTGCGGTCAAAAACGAGGCCCGCATGGGCGCGTCCTTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GGATGCGACGCGTCAATCTTATTG
GACGACACTACGAACTTTACCNGGGAGAAGAACGCCGGCCCGAATGCCAATTCCATGCGGGGATTTGAGGTAATNGACACANTCAAGTCCGAATTGGAGAGCAAGTGCCCCAGTATTGTG
TCCTGCGCTGATATTTTAGCCGTCGTTGCACGAGACTCCATCGTTGCC
TTAGGTGGCCCTAGTTGGACAGTCAACCTTGGAAGAAGAGACTCAACCACTGCAAGTCAAAGTGCTGCTAAT
ATTAGCATTCCTCCCCCAACTTTGAACCTTAGCGGCCTAATCTNTACCTTCTCTAACAAAGGCTTCACAGCTAAAGAAATGGTGGCACTTTTAG
GGTCGCACACTATAGGTCAAGCCCGA
TGCCTGACTTTCCGGGAGCATCTTTACAATGAGAACAACATCGATGCCACGTTCGCGACATCGCTGAAAGCAAATTGCCCAAGCTCCGGAGGCGACAGCAAACTCTTTCCTTTTGACACC
ACAAGCCCGACGTCCTTTGACAACGCCTTCTTCAAGAACTTGCAAACCNACAAGGTTTTTCTTCATTCGGACCAGCAATTGTTCAGTGNTGGCTCCACGGACGTTCACGTGAATGCTTAT
AGTAGCAATTTGTCCACTTTTAGGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTTAGCCCACTCATTGGCTCAAGCNGTCAGATTAGAAAGAATTGCAGGAAAGTCAAC

Retrieve as FASTA