Entry information : EguPrx171-2
Entry ID 11475
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2015-04-21 (Qiang Li)
Peroxidase information: EguPrx171-2
Name EguPrx171-2
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx171-2
start..stop
S start..stop
EgrPrx43 649 0 1..322 1..322
EcamPrx43 647 0 1..322 1..322
EgrPrx45 624 0 1..322 1..322
EglPrx45 624 0 1..322 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5706..5909 204 N° 2 4912..5103 192 N° 3 4654..4816 163 N° 4 3907..4313 407
complement(join(3907..4313,4654..4816,4912..5103,5706..5909))


exon

Literature and cross-references EguPrx171-2
Protein sequence: EguPrx171-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (301)
PWM (Da):   %s   34205.08 (31919.8)  
PI (pH):   %s   8.09 (7.70) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKLLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFHDCFVRGCEGSVLIXSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEAMCKGVVSCADILAFAARDSVEMAGGFGYDVPAGRXDGRVSLASETXNLPPPSFNVDQLTQLFANKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQQCPQGNDPTLXVPMDPPXXNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARIPFIWKKNFAAAMVKMGKIGVLTGSAGEIRANCRVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_1_1028 (5909..3907)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCCTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GTGAGTGAAAACCAATGACACTAACCCATCTTTTGT
TGTAGCTCTAATTGCAATTAATGTTTTCATCAAGGTCAACTAAAAGCGTCGACTAATTTCCTTTCCTTTTTCCTTTGGTTGCATTTTTGTATGCAGAATAATGTGTCAACTAAGAGTTCA
TTAATTCATTGCAATTTACGCCACTCACATGCCATATGCACGTGCGGGCCTCATATGTAGAACATGAATTGACTACTACAAGCTTTTATGTCGATGAANTATCTTTCNATTAATTTAACG
GAACTATCATGACCTAATTAATAGATATGATACGTCTACTAATTATNTTGCACATTCGAATTGGAATATGATACATTTATTCAAAGTTAATTGCTTAACTATATGTGCCTAAATGCATTT
AACAAGTTTAGAGATTTCAATTGTATCTGATATGTTCATTATTCATCTACCAAAGCTGTCTCATTAATCATGCGCCATGCTGTAAATCTTGTTTAATTATGCTCCTCCTAAACTCAATGA
CCNTCACAGAAGTACCTTAGCTCTGTTTCAGGAATGGATTTCATTTGTGAGTNTTAAGAAACATTGCGTGCTTTGATCCATCTTAGGGNTGTGAAGGTTCCGTGCTCATTGANTCCACTC
CGTCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAGCTATGTGCAAAGGAGTTGTTTCCTGTGCTG
ACATACTAGCCTTTGCAGCAAGAGATAGTGTGGAGATG
GTAATCCCGCAAACCCCTTAACTCTGTATATTTACCAACTTGAGCATAAGTTCATCATACTAATAAACATGAGGCGTTCTGT
TTTCTTTTTGTAGGCGGGAGGCTTTGGGTACGATGTTCCTGCAGGAAGAANAGATGGTAGAGTCTCTTTAGCTTCAGAGACTNCAAACTTACCTCCCCCGTCTTTCAATGTCGATCAACT
CACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GTAACTCTTCACTTAGAGCAGCAATCTATGAAATGTGGCTATTTAAGTCCAGATAAAGAATANN
NNNNNNNNNNNNNNNNNNAAGTCCAGATAAAGAATAGAACATCAAGATTATGTAGGAAAGAGTAAAATTAGAGGAAAAAAATGCTCACAGGGACGAATATAAAGGAAAAAATCNTACATG
ATACTATTCTNTTTTTGAAANTGGGGTCCTAGATTTCTGTAATACTTGGCCCATTATGTGTTGTAGGCAACTTACATTCTTGACTCCTCCCCAATTTCATAATCAGAAAAAGGAATATTT
ANATTAAAAAAAAAACTTGCTTCATGCGTGTCACAGGAGCGCATACGATCGGTCGGTCTCACTGCACTTCCTTCAACAATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAA
GCTTGGACCCTACATATGCATCCATGTTGAAGCAACAGTGTCCACAAGGCAATGATCCGACCCTAGNTGTTCCAATGGACCCCCCTANCCNGAACATGATGGATACAAGCTATTATCAGG
GCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTTACTCAAAATGCAAGAATTCCATTCATTTGGAAGAAAAATTTTGCCG
CTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACTGGAAGTGCCGGGGAGATTCGAGCTAATTGCAGGGTCATCAATAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCCTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GGNTGTGAAGGTTCCGTGCTCATTGANTCCACTCCG
TCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAGCTATGTGCAAAGGAGTTGTTTCCTGTGCTGAC
ATACTAGCCTTTGCAGCAAGAGATAGTGTGGAGATG
GCGGGAGGCTTTGGGTACGATGTTCCTGCAGGAAGAANAGATGGTAGAGTCTCTTTAGCTTCAGAGACTNCAAACTTACCTCCC
CCGTCTTTCAATGTCGATCAACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GAGCGCATACGATCGGTCGGTCTCACTGCACTTCCTTCAAC
AATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAAGCAACAGTGTCCACAAGGCAATGATCCGACCCTAGNTGTTCCAATG
GACCCCCCTANCCNGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTTACT
CAAAATGCAAGAATTCCATTCATTTGGAAGAAAAATTTTGCCGCTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACTGGAAGTGCCGGGGAGATTCGAGCTAATTGCAGGGTCATC
AATAGC

Retrieve as FASTA