Entry information : EguPrx191
Entry ID 11484
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-19 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx191
Name EguPrx191
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx191
start..stop
S start..stop
EcamPrx191 640 0 1..317 1..317
EglPrx191 637 0 1..317 1..317
EgrPrx191 635 0 1..317 1..317
PtPrx53 504 0 4..317 3..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20458..20670 213 N° 2 21314..21505 192 N° 3 21758..22303 546  
join(20458..20670,21314..21505,21758..22303)


exon

Literature and cross-references EguPrx191
Protein sequence: EguPrx191
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (293)
PWM (Da):   %s   33963.98 (31493.7) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.19 (9.38) Peptide Signal:   %s   cut: 25 range:25-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNSNFPIVAVIIVSLLVCLTNAQLSPNFYTRTCPNVQGIVRNAMTQAVRREPRMGASILRMFFHDCFVNGCDASVLLDDTATFTGEKTARPNQNSLRGFEVIDTIKSRVEAACNATVSCADILALAARDGVVQLGGPSWXVPLGRRDARTASLSGANSQIPSPFSSLATLISSFAAQGLNARDMTALSGGHAIGLARCTTFRNRIYNETNIDASFATTRRTNCPASGGDANVAPLDRTPNRFDNNYYQNLVARRGLLHSDQELFNGGSQDALVRTYSNNYRAFASDFAAAMVKMGNISPLTGRNGEIRRNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
scaffold_11_36606 (20458..22303)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCAATAGCAACTTCCCCATTGTCGCTGTCATTATTGTATCCCTTCTCGTGTGCCTTACGAACGCACAGCTTTCGCCAAACTTCTACACAAGAACATGCCCCAACGTACAAGGC
ATTGTCCGCAATGCGATGACGCAAGCTGTTAGGAGAGAGCCGAGGATGGGTGCTTCAATACTTCGCATGTTCTTCCATGATTGTTTCGTAAAT
GTGCGTAACTAGGATTCTTTTGCGTTC
ATTTCTAATTATTACTTCTTTCAAGAACATTTTTGGTTGCATTTTATTTGCGAAGGTTNAATTAGATTTTCTAGTCATTTNAAATATCCAGGCATGTTGATCTCGTAAAGTTGATTTTAG
TGTTGAGTANAATGTCACGTCATTTGAATAGGTGAGGTTATAACATGCCCTTTAAATATGCAGGCCCCCTCTTAAGTTGTTGGGTGGACATTTTNACATTTTATAAAATTTAGGTTTATA
TATATATATATATATATATATTTATACACGTGCCATATAGTGCAGATCCGTATTTTCTAAGNAGATNAGGATTAGNTACTACATTCAAAGAAGCATTGAATTTGCTTGACTCCCATTTGT
TAAGTATCCATGAAATTGACTTGGATTTTGGAGGGGCAAGAAAAGCACACGATGAGATTATATATCCTTTCTGAACTTATTCTACTAGATGATTTAAACTAATCATCCGATCTAAGAAAA
CTTCTGCCNNATGTGCTCAATCCATCACTAATCAAAAGATGAAAAAAAGATGAACTCTTAATTAAGTGATANGGTGCAAAATTGTGACCTTCTCTTTCGAAACAATCTTATCATGTATCT
CGGCCTTCTTGTGTAGGGATGTGACGCATCGGTTCTTTTGGATGACACCGCTACCTTCACCGGAGAAAAGACCGCTCGGCCGAACCAAAACTCTCTTAGGGGATTCGAAGTCATCGACAC
CATTAAGTCCCGTGTCGAAGCTGCTTGCAATGCTACCGTTTCTTGCGCGGACATCCTTGCGCTCGCTGCTCGAGACGGCGTTGTCCAA
GTGAGTGTCTCATATATCATGATCGTTACTAA
CTTTTGCTCCTATTTTCTCTTTAATGCATGATTTTGGTTTATATTAACTTCAAATCTCTGACCATACCAATTACATAATAGTNATCCGCTGTTTCATGATTGGATTAGTCCATATTGATG
GGATAAATTCGCAATTTTTTATACATAACATTTTTATAGAAGNCTGAACATTNGCAAACATAAATTGTATAAGCTTATGCGATTGATATTGGCATTANAGTTGGGAGGACCATCGTGGNC
GGTGCCTCTAGGGCGGCGAGATGCAAGGACCGCTAGCCTGAGCGGTGCCAACAGCCAAATCCCATCGCCTTTCTCCAGCCTNGCCACCCTCATCTCCTCCTTCGCNGCCCAAGGCCTCAA
TGCCCGTGACATGACCGCCCTGTCTGGGGGCCATGCTATTGGCCTGGCCCGGTGTACCACCTTCCGGAACCGCATCTACAATGAGACCAACATCGACGCCAGCTTCGCTACCACCCGAAG
GACTAACTGCCCTGCCTCTGGAGGGGACGCCAACGTTGCTCCCCTCGACCGGACCCCNAACCGGTTTGACAACAACTACTACCAGAACCTCGTGGCACGGCGTGGGCTCCTCCATTCGGA
TCAAGAGCTGTTCAATGGAGGATCACAGGACGCACTCGTTAGGACTTACAGCAATAACTATAGGGCTTTCGCGAGTGATTTTGCGGCTGCGATGGTGAAGATGGGTAACATCAGCCCGCT
CACCGGAAGAAATGGNGAGATCAGAAGGAACTGTAGGGTGGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCAATAGCAACTTCCCCATTGTCGCTGTCATTATTGTATCCCTTCTCGTGTGCCTTACGAACGCACAGCTTTCGCCAAACTTCTACACAAGAACATGCCCCAACGTACAAGGC
ATTGTCCGCAATGCGATGACGCAAGCTGTTAGGAGAGAGCCGAGGATGGGTGCTTCAATACTTCGCATGTTCTTCCATGATTGTTTCGTAAAT
GGATGTGACGCATCGGTTCTTTTGGAT
GACACCGCTACCTTCACCGGAGAAAAGACCGCTCGGCCGAACCAAAACTCTCTTAGGGGATTCGAAGTCATCGACACCATTAAGTCCCGTGTCGAAGCTGCTTGCAATGCTACCGTTTCT
TGCGCGGACATCCTTGCGCTCGCTGCTCGAGACGGCGTTGTCCAA
TTGGGAGGACCATCGTGGNCGGTGCCTCTAGGGCGGCGAGATGCAAGGACCGCTAGCCTGAGCGGTGCCAACAGC
CAAATCCCATCGCCTTTCTCCAGCCTNGCCACCCTCATCTCCTCCTTCGCNGCCCAAGGCCTCAATGCCCGTGACATGACCGCCCTGTCTGGGGGCCATGCTATTGGCCTGGCCCGGTGT
ACCACCTTCCGGAACCGCATCTACAATGAGACCAACATCGACGCCAGCTTCGCTACCACCCGAAGGACTAACTGCCCTGCCTCTGGAGGGGACGCCAACGTTGCTCCCCTCGACCGGACC
CCNAACCGGTTTGACAACAACTACTACCAGAACCTCGTGGCACGGCGTGGGCTCCTCCATTCGGATCAAGAGCTGTTCAATGGAGGATCACAGGACGCACTCGTTAGGACTTACAGCAAT
AACTATAGGGCTTTCGCGAGTGATTTTGCGGCTGCGATGGTGAAGATGGGTAACATCAGCCCGCTCACCGGAAGAAATGGNGAGATCAGAAGGAACTGTAGGGTGGTGAAC

Retrieve as FASTA