Entry information : EguPrx192
Entry ID 11485
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-19 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx192
Name EguPrx192
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx192
start..stop
S start..stop
EgrPrx192 705 0 1..346 1..346
EcamPrx192 705 0 1..346 1..346
EglPrx192 705 0 1..346 1..346
TsPrx09 532 0 2..346 1..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12860..13129 270 N° 2 13408..13599 192 N° 3 13839..14004 166 N° 4 14191..14600 410
join(12860..13129,13408..13599,13839..14004,14191..14600)


exon

Literature and cross-references EguPrx192
Protein sequence: EguPrx192
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (322)
PWM (Da):   %s   36619.48 (34343.2)  
PI (pH):   %s   5.96 (5.96) Peptide Signal:   %s   cut: 25 range:25-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVALSXVVFALVASAFLLSTPSTAHPGLGFGWGGGSSGSGGGHGLFPEYYLYSCPQVNDIVVSVLEQAIEREPRMAASLLRLHFHDCFVQGCDASVLLDDSATIASEKRSLPNANSLRGFEVIDEIKAKLEEVCPGVVSCADIVALAARGSTVLSGGPDWELPLGRGDSRTASLTGSNNNIPPPNSTIQNLITLFQRQGLNEADLVALSGGHTIGVARCTSFKQRLYNQNGNNQPDATLERTYYQDLKTVCPQSGGDNNISPLDIASPVKFDNSYFKLXLWGKGLLNSDEVLLTGKVGKTMNLVKAYAEDESLFLQQFAKSMIKMGNISPLXGFNGEVRKNCRHV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_6_20921 (12860..14600) .
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCTCTCTCCNAAGTAGTCTTTGCTCTTGTGGCCTCGGCTTTCCTGTTGTCCACACCTTCCACAGCTCACCCGGGCCTTGGCTTTGGTTGGGGTGGGGGCTCCAGCGGAAGTGGC
GGGGGTCATGGCCTGTTTCCCGAATACTATCTTTACTCGTGCCCTCAAGTGAACGACATTGTTGTTTCGGTGCTGGAGCAAGCCATCGAAAGGGAACCGAGGATGGCAGCTTCCTTGCTC
CGGCTTCATTTCCACGACTGCTTTGTGCAG
GTTTGATTTTCACAAGTTTGGCAACCGGTTTTATGATTGCTTCAGAACTCGCGAAAAATATATTCTCAACGGCAAGAAAGGAATCAAAGG
GGATTGATGCAAAATGACAAGAGCTAAGAAAACTAACAGTAGTCGGGTGTTTTCCCTCTTCCAATGCAAGTCAGAGAGACTAAAGCATATGCCTACGTTACCTAAAGAAATGTCGGGTTG
GATCCATTAGAGCTGCTTAGTGCCTGCAATGTAGGAGTAGCCGTTGCTTAACAAGCTATTTGTTGTAGGGATGTGATGCATCAGTTCTGCTGGACGATAGTGCGACCATAGCCAGCGAGA
AGAGGTCGCTGCCTAATGCAAACTCCCTCAGGGGGTTTGAAGTGATAGATGAAATCAAGGCCAAGTTGGAAGAAGTGTGCCCTGGTGTTGTGTCTTGTGCAGATATTGTCGCCCTTGCAG
CGCGTGGATCTACCGTTCTG
GTACGTTAGATACTCCTTTTGTATTCCTCACTCTTGTTGAATGCTTAAATGTCAAGATCAAAACCGTGAGTCACTTCCACTTAAAATCCCCAGTTTAGAC
TTACCAAAGGTGTCCATATTCGAACATGTAAGACCGCCAAGACCATCAGAAAGTGACATTTCTTCTGTAGTTTTACTTCCTTAGATTGACTAACAATTTAGCTTCATTTTTTTTTTTTTT
TTCGGTTGAGATTTAACAGAGCGGTGGACCAGATTGGGAGCTTCCTCTTGGAAGGGGGGACTCTAGAACAGCAAGTCTTACGGGCTCTAATAACAATATCCCCCCTCCAAACTCCACAAT
CCAAAATCTCATCACACTCTTCCAGCGCCAAGGCCTAAATGAAGCCGATCTCGTCGCTCTCTCAG
GTACCACCCATTATTCAGCACTGAAAAATCATTAGGTGGGCTCTCTCNGTCACCA
ATTTTCTAAATTAATGTTGATTACAGCAAGGCAAAAACATGAAAACTGATTTCTGTTACCGATTTCTTTCCTTTTCATAATAAGATTCTGTCAGTGTAACATATTGCGAATTTTATNGTC
GGTATCTGCAGGAGGGCACACGATTGGGGTGGCGAGGTGTACAAGCTTCAAGCAGAGGCTGTACAACCAGAATGGGAACAACCAACCCGATGCGACTCTTGAGAGGACCTACTACCAGGA
TCTGAAAACAGTTTGCCCTCAGTCGGGTGGTGACAACAATATCTCTCCCCTGGACATTGCTTCCCCGGTCAAGTTTGACAACTCCTACTTCAAGCTTNTATTATGGGGCAAAGGCCTTCT
CAATTCAGATGAAGTGCTCTTAACNGGAAAAGTGGGGAAGACTATGAATCTGGTCAAAGCCTATGCAGAAGACGAGAGCCTCTTCCTCCAGCAGTTTGCCAAGTCCATGATCAAGATGGG
TAACATCAGTCCTCTCANTGGGTTTAACGGCGAAGTGAGAAAGAATTGTCGCCATGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCTCTCTCCNAAGTAGTCTTTGCTCTTGTGGCCTCGGCTTTCCTGTTGTCCACACCTTCCACAGCTCACCCGGGCCTTGGCTTTGGTTGGGGTGGGGGCTCCAGCGGAAGTGGC
GGGGGTCATGGCCTGTTTCCCGAATACTATCTTTACTCGTGCCCTCAAGTGAACGACATTGTTGTTTCGGTGCTGGAGCAAGCCATCGAAAGGGAACCGAGGATGGCAGCTTCCTTGCTC
CGGCTTCATTTCCACGACTGCTTTGTGCAG
GGATGTGATGCATCAGTTCTGCTGGACGATAGTGCGACCATAGCCAGCGAGAAGAGGTCGCTGCCTAATGCAAACTCCCTCAGGGGGTTT
GAAGTGATAGATGAAATCAAGGCCAAGTTGGAAGAAGTGTGCCCTGGTGTTGTGTCTTGTGCAGATATTGTCGCCCTTGCAGCGCGTGGATCTACCGTTCTG
AGCGGTGGACCAGATTGG
GAGCTTCCTCTTGGAAGGGGGGACTCTAGAACAGCAAGTCTTACGGGCTCTAATAACAATATCCCCCCTCCAAACTCCACAATCCAAAATCTCATCACACTCTTCCAGCGCCAAGGCCTA
AATGAAGCCGATCTCGTCGCTCTCTCAG
GAGGGCACACGATTGGGGTGGCGAGGTGTACAAGCTTCAAGCAGAGGCTGTACAACCAGAATGGGAACAACCAACCCGATGCGACTCTTGAG
AGGACCTACTACCAGGATCTGAAAACAGTTTGCCCTCAGTCGGGTGGTGACAACAATATCTCTCCCCTGGACATTGCTTCCCCGGTCAAGTTTGACAACTCCTACTTCAAGCTTNTATTA
TGGGGCAAAGGCCTTCTCAATTCAGATGAAGTGCTCTTAACNGGAAAAGTGGGGAAGACTATGAATCTGGTCAAAGCCTATGCAGAAGACGAGAGCCTCTTCCTCCAGCAGTTTGCCAAG
TCCATGATCAAGATGGGTAACATCAGTCCTCTCANTGGGTTTAACGGCGAAGTGAGAAAGAATTGTCGCCATGTTAAT

Retrieve as FASTA