Entry information : EguPrx21
Entry ID 11490
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx21
Name EguPrx21
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx21
start..stop
S start..stop
EgrPrx21 643 0 1..319 1..319
EglPrx21 643 0 1..319 1..319
EcamPrx21 638 0 1..319 1..319
EcamPrx22 637 0 1..319 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4129..4344 216 N° 2 5923..6114 192 N° 3 6237..6402 166 N° 4 6511..6893 383
join(4129..4344,5923..6114,6237..6402,6511..6893)


exon

Literature and cross-references EguPrx21
Protein sequence: EguPrx21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   33212.34 (30515.9)  
PI (pH):   %s   8.15 (8.21) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARESSSVRSAFLLLLCFLLETASAQLSSTFYSTSCPSALSTIKSGVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTANFTGEKNAGPNANSLRGFNVIDTIKSQLESACPGIVSCADLLTVAARDSVVALGGPSWTVPLGRRDSTTASQSAANSNIPAFTLSLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTFRTRLYNENNINXTFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQKGLLHSDQQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKSCGKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_1_736 (4129..6893)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGTGAGAGCTCTTCTGTCAGATCCGCCTTCTTATTGTTGCTGTGTTTTCTTCTGGAAACAGCCTCAGCTCAGCTGTCCAGTACTTTCTACTCCACCTCCTGTCCCAGCGCCCTC
TCCACCATTAAATCCGGCGTGAGCTCTGCGGTCAAAAGTGAGGCCCGCATGGGCGCATCGCTGCTCCGCCTTCACTTCCACGATTGCTTCGTTAAT
GCAAGTCCCTCTGCCCGGAGTCTC
TCCTCTCTTTCCGATTGATTGCTACCTTTGTTTCTCTTCTGTCATTCAAGCTGCATGCAAGCGTGCATGCATGATGCATCTTTGTGCTTTTGTGCATGTGAAACGTTCCAACCGACCTCA
TAGTNAAAAAGAATGATTAGATTTCGCTTCTACGCAAGTTACTCTCTTTTTCACTAACCAAACAATAGGTAGGAAGTACACATATTGAATTAATCGAGTCTGACCGACCCTTTTTGTGCC
ATGCATTTTTGTGAGTTTNTTATTATNATNATAATAATAGGCTGTGTTTATTGAAGTCGTTTTAAAATTAGAGNTATGTTTTCATTCAAACAGCAATAAAAAGCACGGCCCTTAGAATAA
AAGCACTTCTTTTTGGTGATTCAAAGAAAAAAAAATTTCATGAGTAATTCTAGTATACACCGCTAGTGTAAAATTCTCATTCCGTAAGTGGTCTTATCTACTAGATATTTTGGTGGTTGG
GGAGAGATTTGGTAATTAGAATCCTCGAATCAAGATGGACAAGAATATTGTTGTGCGTGCTCTAATTTTTTTTTTTTTCATTTATTATATCGACAATGTAAGCCATGCAGGCGAGCGTAT
TTTATGCCGAGTATGTTGTGGATAAGACGTGTTTGTGTATGATTAGCTACATGATTTTAAATTCGATNAATTAGATCACGCAAAAGTCCTAAACGTTGGAGATGGCAAAAAGAGAGAGCG
ACAGCCATGCTTTTATGACGGTGGTTGACTTTACGCGTTTNTCANGTTTGGCAAATCAATNAGTTGTTTTCAATAGGTTTTGGTCATATTTTGATCACTGTCACTTTGGTTGCCATACTT
TCCTACATTGAAAATGATATTTTGCTATAAATATCTTTTTTTAATGAAATTTGTTAATCCAATGGAGTTCTAAAAATTGTGTTAGATCTTTTGAACAATTTGAAGAACCTTCATTGTTAT
CCACTTCGTGTTCTTTGTGCATAATTCAAGAGTTGTCCATATCCTAATGGGCCTTTCTCCATCAAACATGCCGTCTCTATTTCAAACTTGATATTTAAGCCTGATCCATTTTTCTCGATT
AGATGCTTTTCTCTTTTCCTGTATGGGTTGGAAATTGTCTAGATCTTCAAGGTCATTCGAGAAGACAAAATTCAGGCTAATTCTAGTAAATCAAAAAGTCGGTGACTCCCCTCTGTTAAA
TATTAAAGGACACGCCATGTTGCTAACCAAAAGCCTTGATTTAGAAAAACATCATAGCACAATCATTTTGTTTCTAGTCCGACAATTATTGGATGCATTATTTCTAGAGAGACGACACAA
ATTANAGTCAAAAGGCACGAGAAAGANTGTCATTCCCGTCCAAACTGGTGTCTGCAGGCGTTCATAATGGGGGACAAAAGGGGGAAAATGATAAGGGAAATTAATCAGTGTTCATACTTT
ATGTTCAGGAAAAGTTATAGCACTCGTTCTNTTTATATTTTGACCGTTGAATCTAATGAATTCAATAGGATCGATTTGACTAATTAACGATGTGTGGCACAAAATATANAATAGGGATGC
GACGCATCTGTTCTATTGGACGACACTGCAAACTTCACTGGGGAGAAGAATGCTGGCCCAAATGCCAATTCCTTACGGGGATTCAACGTGATTGACACAATCAAATCCCAATTGGAGAGT
GCATGCCCCGGCATCGTGTCCTGCGCTGATCTCTTGACCGTGGCTGCGCGAGATTCCGTCGTCGCT
GTAAGTGCACACTTTTTTCTTAATTCTAGTGATCAATNGTGATGAGAAAAAATC
ACTCNTTATGATCTCGATGCCGCANCAATACTAACACGTGTGGATTTNTTTAACTATTAAATTCTTAGTTAGGTGGCCCAAGTTGGACAGTCCCGCTAGGAAGAAGAGACTCAACCACTG
CAAGCCAAAGTGCTGCTAATAGCAACATCCCTGCCTTTACTTTGAGCCTTAGCGGCCTCATCACTGCCTTCTCTAACAAAGGTTTCACCGCCAAAGAAATGGTGGCACTCTCAG
GTCATT
ATTTTTCTTTTTTTTGTGGCACCTTTTAATAACGAATTTACAATTATGCTNNATCGATATACTAAGATTAATATTAAAAAGTTGTTCGATTGTTGNTAACAGGGTCGCACACGATAGGTC
AAGCCCGATGCACAACTTTCCGGACCCGTCTTTACAACGAGAACAACATCAACNCCACGTTCGCAACCTCGCTCAAGGCGAACTGCCCAAGCTCCGGAGGCGACAACAATCTCTCTCCTC
TAGACACCACGAGCCCGACGTCCTTCGACAATGCCTACTTTAAGAACTTGCAAATCCAAAAAGGTCTTCTTCACTCGGACCAGCAATTGTTTAGTGGTGGTTCCACGGACGCTCAAGTGA
ACGCTTATAGCAGCAATTCAGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTCAGCCCGCTCACCGGCTCAAGCGGTCAGATTAGGAAGAGTTGCGGGAAAG
TCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGTGAGAGCTCTTCTGTCAGATCCGCCTTCTTATTGTTGCTGTGTTTTCTTCTGGAAACAGCCTCAGCTCAGCTGTCCAGTACTTTCTACTCCACCTCCTGTCCCAGCGCCCTC
TCCACCATTAAATCCGGCGTGAGCTCTGCGGTCAAAAGTGAGGCCCGCATGGGCGCATCGCTGCTCCGCCTTCACTTCCACGATTGCTTCGTTAAT
GGATGCGACGCATCTGTTCTATTG
GACGACACTGCAAACTTCACTGGGGAGAAGAATGCTGGCCCAAATGCCAATTCCTTACGGGGATTCAACGTGATTGACACAATCAAATCCCAATTGGAGAGTGCATGCCCCGGCATCGTG
TCCTGCGCTGATCTCTTGACCGTGGCTGCGCGAGATTCCGTCGTCGCT
TTAGGTGGCCCAAGTTGGACAGTCCCGCTAGGAAGAAGAGACTCAACCACTGCAAGCCAAAGTGCTGCTAAT
AGCAACATCCCTGCCTTTACTTTGAGCCTTAGCGGCCTCATCACTGCCTTCTCTAACAAAGGTTTCACCGCCAAAGAAATGGTGGCACTCTCAG
GGTCGCACACGATAGGTCAAGCCCGA
TGCACAACTTTCCGGACCCGTCTTTACAACGAGAACAACATCAACNCCACGTTCGCAACCTCGCTCAAGGCGAACTGCCCAAGCTCCGGAGGCGACAACAATCTCTCTCCTCTAGACACC
ACGAGCCCGACGTCCTTCGACAATGCCTACTTTAAGAACTTGCAAATCCAAAAAGGTCTTCTTCACTCGGACCAGCAATTGTTTAGTGGTGGTTCCACGGACGCTCAAGTGAACGCTTAT
AGCAGCAATTCAGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTCAGCCCGCTCACCGGCTCAAGCGGTCAGATTAGGAAGAGTTGCGGGAAAGTCAAC

Retrieve as FASTA