Entry information : EguPrx23
Entry ID 11492
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx23
Name EguPrx23
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx23
start..stop
S start..stop
EcamPrx23 636 0 1..319 1..319
EgrPrx23 611 0 1..319 1..319
EcamPrx21 592 0 1..319 1..319
EcamPrx22 588 0 1..319 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28173..28388 216 N° 2 30103..30294 192 N° 3 30417..30582 166 N° 4 30690..31072 383
join(28173..28388,30103..30294,30417..30582,30690..31072)


exon

Literature and cross-references EguPrx23
Protein sequence: EguPrx23
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   33360.42 (30708.0) Transmb domain:   %s   i12-34o
PI (pH):   %s   7.99 (7.99) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAWESSSVRTAFLLLLSFLLGTASAQLSSTFYSTSCPSALSTIKSGVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDXANFTGEKTARPNNNSLRGFDVIDTIKSQLESACPGVVSCADLLTVAARDSVVALGGPSWTVPLGRKDSTTASQSAANSNIPAPTLNLSGLITAFSNKGFTTKEMVALSGSHTIGQARCTTFRARLYNENNINTTFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQEGLLHSDQQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_1_740 (28173..31072)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGGGAGAGCTCTTCGGTCAGAACCGCCTTTTTATTGTTGCTGTCTTTCCTTCTGGGAACAGCCTCGGCTCAGCTGTCCAGTACTTTCTACTCCACCTCCTGTCCCAGCGCCCTC
TCCACCATTAAATCCGGCGTGAGCTCTGCGGTCAAAAGTGAGGCCCGCATGGGCGCATCGCTGCTCCGCCTTCACTTCCACGATTGCTTCGTTAAT
GCAAGTCCCTCTGCCCGGAGTCTC
TCCTCTCTTTCCGATTGATTGCTACCTTTGTTTCTCTTCTGTCATTCAAGCTGCATGCAAGCGTACATGCATGATGCATCTTTGTGCTTTTGTGCATGTGAAACGTTCCAACCGACCTCA
TAGTCAAAAAGAATGATTAGATTTCGCTTCTACGCAAGTTACTTACTCTCTTTTTCACTAACCAAACAATAGGTAGGAAGTACACATATTGCATTAGTCGAGTCTGACCGACCCTTTTTG
TGCCATGCATTTTTGTGAGTTTATTATTATTTTAATAATAGGCTGTGTTTATTGAACTCGTTTAAAATTAGAGTTATGTTTTCATTCAAACAGCAATAAAAAGCACGGCCCTCAGAATAA
AAGCACTTCTTTTTGGTGATTCAAAGAAAAAAATTTCATGAGTAATTCTAGTATACACCGCTAGTGTAAAAATCTCATTCCGTAAGTGGTCTTATCTACTAGATATTTTGGTGGTTGGGG
AGAGATTTGGTAATTAGAATCCTCGAATCAAGATGGACAAGAATATTGTTGTGCGTGCTCTAATTTTTTTTTTTCATTTATTAAATTGATAATGTATTCTATAACTTCATTACAAAAGCC
ATGCAGGCGAGCGTATTTTATGGCGAGTATGTTGTGGTTGTGGATAAGACGTGTGTATGTATCATTAGCTACATGATTTTAATTCGATGAATTAGATCACGCAAAAGTCCCAAACGTTGG
AGATGGCCAAAAGAGAGAGCGACAGCCTTGCTTTTATGACGGTGGTTGACTTTACGCGTTTATCATGTTTGGCAAATCAATCAGTTGTTTTCAATAGGTTTTGGTCATATTTTGATCACC
GTCACTTTGGTTGCCATACTTTTCTACATTAAAAATGATATTTTGCCATAAAATATCTTTTTTTAATGAAATTTGTTAGTCCAATGGTGTTCTAAAAATTGTATTAGATCTTTTGAACAA
AACAAAAAGTGCCTTGTGCATGGCCTCACTACTTTGCTTCCAACACAAATTTAGAGTGTCAATCTAAATTAACTAATCAATTTGAAGTACCTTCACTATTATCCACTTCGTGTTCTTTGT
GCATAATTCAAGAGTTGTCCATATCCTAACGGGCCTTTCTCCATCAAACATGTCGTCTCTATTTTGAGCTTGATATTTAAAGCCTNATCCTTTTTTTACTAACAAATGTGACATGTTTAT
AACTTTCTTGATTAGATGCATTTCTCTTTTCCTGTATGGATTGGAGATTGTCTAGATCTTCGAGGTCATTCAAGTAGACATAATTCAGGTTAATTTTAGTAAATCAAAAAGTCGGTGACT
CCCCTCTGTTAAATATTAAAGGACACGGCATGTTGCTGACCAAAAGCCTTTATTTAGAGAACACTTGAGAGCACAATCATTTNGTTTCTAGTCCGACAATTATTGGATGCATTGTTCCTA
GAGAGACAACACAAATTAAAGTCAAAAGGCATGAGAAAGAGTGTCATTTCCGTCCAAACTGGTGTCTGTGGGCGTTCATAACGGGGGACAAAAAGGGGGAATATGATAANGGAAATTAAT
CAGTGTTCATACTTTATGTTCAGGAAAAAGTTACAGCACTTGTTCTGTTTATATTTTGACCGTCGAATCTAATGAAGGCANTAGGATTGATTTGACTGATTAACGATGTGTGGCACAAAA
CATAATATAGGGATGCGACGCATCTGTTTTGTTGGATGACANCGCGAACTTCACTGGGGAGAAGACTGCTCGCCCAAACAACAATTCCTTACGGGGATTTGATGTGATTGACACGATCAA
GTCCCAATTGGAGAGCGCATGCCCCGGTGTTGTGTCCTGCGCTGATCTCTTGACTGTGGCTGCCCGAGATTCCGTCGTCGCT
GTAAGCGCACACTTTCTTCTTAATTCTAGTGATCAATT
GTGATGAGAAAAAATCACTCGTTATGATCTCGATGCTGCATCAATACTAACACGTGTGGATTTGTTTGACTATTTAATTCTTAGTTAGGTGGCCCAAGTTGGACAGTCCCGCTAGGAAGA
AAAGACTCAACTACTGCAAGCCAAAGTGCTGCTAATAGCAACATCCCTGCCCCGACTTTGAACCTTAGCGGCCTCATCACTGCCTTCTCTAACAAAGGTTTCACCACCAAAGAAATGGTG
GCACTCTCAG
GTCATTGTTTTTCCTTTTTTGTGGCACCTTTTAATAACGAATTTACAATAATGCTTGATCGATATACTAAGATTAATATTAAGAAGTTGTTCGATTGTTGTTAATAGGGT
CGCACACGATAGGTCAAGCCCGATGCACAACTTTCCGGGCCCGTCTTTACAACGAGAACAACATCAACACCACGTTCGCAACCTCGCTCAAGGCGAACTGCCCAAGCTCCGGAGGTGACA
ACAATCTCTCTCCTCTAGACACCACGAGCCCGACGTCCTTTGACAATGCCTACTTTAAGAACTTGCAAATCCAAGAAGGTCTTCTTCACTCGGACCAGCAATTGTTTAGTGGTGGTTCCA
CGGACGCTCAAGTGAACGCTTATAGCAGCAATTCAGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTCAGCCCGCTCACCGGCTCAAGCGGTCAGATTAGGA
AGAACTGCAGGAAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGGGAGAGCTCTTCGGTCAGAACCGCCTTTTTATTGTTGCTGTCTTTCCTTCTGGGAACAGCCTCGGCTCAGCTGTCCAGTACTTTCTACTCCACCTCCTGTCCCAGCGCCCTC
TCCACCATTAAATCCGGCGTGAGCTCTGCGGTCAAAAGTGAGGCCCGCATGGGCGCATCGCTGCTCCGCCTTCACTTCCACGATTGCTTCGTTAAT
GGATGCGACGCATCTGTTTTGTTG
GATGACANCGCGAACTTCACTGGGGAGAAGACTGCTCGCCCAAACAACAATTCCTTACGGGGATTTGATGTGATTGACACGATCAAGTCCCAATTGGAGAGCGCATGCCCCGGTGTTGTG
TCCTGCGCTGATCTCTTGACTGTGGCTGCCCGAGATTCCGTCGTCGCT
TTAGGTGGCCCAAGTTGGACAGTCCCGCTAGGAAGAAAAGACTCAACTACTGCAAGCCAAAGTGCTGCTAAT
AGCAACATCCCTGCCCCGACTTTGAACCTTAGCGGCCTCATCACTGCCTTCTCTAACAAAGGTTTCACCACCAAAGAAATGGTGGCACTCTCAG
GGTCGCACACGATAGGTCAAGCCCGA
TGCACAACTTTCCGGGCCCGTCTTTACAACGAGAACAACATCAACACCACGTTCGCAACCTCGCTCAAGGCGAACTGCCCAAGCTCCGGAGGTGACAACAATCTCTCTCCTCTAGACACC
ACGAGCCCGACGTCCTTTGACAATGCCTACTTTAAGAACTTGCAAATCCAAGAAGGTCTTCTTCACTCGGACCAGCAATTGTTTAGTGGTGGTTCCACGGACGCTCAAGTGAACGCTTAT
AGCAGCAATTCAGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTCAGCCCGCTCACCGGCTCAAGCGGTCAGATTAGGAAGAACTGCAGGAAAGTCAAC

Retrieve as FASTA