Entry information : EguPrx24
Entry ID 11493
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx24
Name EguPrx24
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx24
start..stop
S start..stop
EglPrx24 640 0 1..318 1..318
EgrPrx24 637 0 1..318 1..318
EcamPrx24 626 0 1..318 1..319
EgrPrx25 560 0 1..318 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31417..31632 216 N° 2 33353..33541 189 N° 3 33891..34056 166 N° 4 34163..34545 383
join(31417..31632,33353..33541,33891..34056,34163..34545)


exon

Literature and cross-references EguPrx24
Protein sequence: EguPrx24
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (293)
PWM (Da):   %s   33412.24 (30814.9) Transmb domain:   %s   o10-32i
PI (pH):   %s   6.96 (6.98) Peptide Signal:   %s   cut: 26 range:26-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACESSSVKPVYLLLLCFLLGTASAQLSSTFYSKSCPSALRTIKSGVSSAVFSEARMGASLLRLHFHDCFVNGCDASIXLDDTTNFTGEKTAGANNNSIRGYEVIDTIKSHLESSCPGVVSCADILAIAARDSVVLGGPSWTVLLGRRDSTTASLTDANSNIPAPTLSLSDLTTSFSNKGFTAKEMVALSGSHTIGQARCTSFRTRLYNENDINATFATSLNANCPSSGGDNNLSPLDTTSPTYFDNGYFKNLQTQKGLLHSDQQLFSGGSTDAQVNTYSSNSATFMTDFANAMVTMGNLSPLTGSSGQIRKNCRKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_1_742 (31417..34545)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCTGTCAAACCCGTCTACTTATTGTTGCTGTGTTTCCTCCTCGGAACAGCCTCAGCTCAGCTGTCCAGCACTTTCTACTCCAAATCCTGTCCCAGCGCCCTC
CGCACCATTAAGTCTGGCGTGAGCTCCGCCGTGTTCAGCGAGGCCCGCATGGGCGCATCACTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GCAAGTCCCNCTCCTCTGTGTCTG
TCCTCTCTTTCCCATTGATTTCTACCTTTGTCTCCCTTCTGTCATTCAAGCTTCATGCAAGCGTGCATGCATGATGCATCTTTGCGCCTGTACTTGTGAAACATTCCAACCAACCTCATA
GTCAGGAGCATCATTAGATTTCGCTTCTACGCATTGAATTAGTCGAGTCTGACCGACCCCTCTTGGTATATTGTCGTGCCATGCATTTTTGCGAGTCTATTAGCATAATAATAACAGGCT
CTGTTTATTGAAGTCGTTTTAGAATTAGAGCCATGTTTTCATCATACAGCAATAAAAGGCATGGCCCTTAGAATAAAAGCACTTCTTTTTGGTGATTCAAAGAGAAAATTTTCATGAGTA
ATTCTAGCATACACCGCTAGTGTAAAAATATCATTCCATAAGCGGCCTTATCCACTAGATATTTTGGTGGTTATGAAGAGATTTGGTAATTATAATCCTCCAATCATGGGTGGATAAGAA
TGTTGTTGTGTGTACTCTAATCTTTTTTTTTAAATTACAGACAGTATATGCTCTACTTTTCTTTATTACAAAAGCCATGCAGGTGAACGTACTTTGTGCTGAGTATTTGTTGACAAGATG
TGTGTATGTGTATGATTAGCCCTGGTTTAAACCCGATGAACTCGATGATTTAGATCATGCAAAAGTCNTAAACGTTGCAGCTGGAAAAGAGAGAGAGAGATGGCCATGCTTTATAAGTCG
GTGGTTGACTTTATNCGAACATCGCGTTTGGCAAAACCAATCAGTCTTTCTCAATAGGTTTCAATCATANTTTGATCACCGTCCTTTGGTTGCGATACTTTTCTACATTAAAAATCATGT
TTTATGGTAAAANATCATTTTTAATGGAATTTGTTAATCCAATGGTATTCTAAAAATCACATTAGATCTTTGAATAAATGAATTGTGCCTTGTGCATGGCCTCACTAGTCTTCTTCCAAC
CCGAATTTAGAGTGACAATCTAAATTAACAAATCAATTTAGTATACCTTCTTTGTAATCCTCTTTGTATTCTTTGTGCATAATTTAAGAGCTGCCCACATCATAATGGACCTTTCTCCAT
CAAACATGGCGTCTCTATTTTGATCTTGATATTTAAAGCCTAATCGATTTTTTAAATAACAAATATGATGTGTTTACAACTTTCTCGATTAGATTTGTGGGTTGCTTTTCCTTTTTCCTG
TATAGGTTGGAAATCGTCTAGATTTTCAATTTTAATCGATAGATAATTGGTCATTTGAGAAGGCCAAACTCAGGCTAATTCTAGTNAATCATAAAGTCGCTGACTTTCCTCTGTTAAATA
TTAAAGAACGCGCCATGTTGCTAACCAAAAATCTTGATTTAGAGAACTCTTCACAGCGCAATCATTTTGTTTCTAGTCNGACGATTATTGGATGCATTGTTCCTTGAGAAACAACACGGA
GTAAAGTCAAAAGGCATGAGAAAGAGTGTTCCCCCCCCCGCCGCGCGGTCCAAACTGGTGTCTCTAGGCGTTCATAATGGGGGACAAAAAGGGGAGAACGATAAGGGAAACAACCAGTGT
TTATGCTCTAACTTCAGAAAAAAATTAAAACACTCAAACNTCNTNTNTACAACTAANGAANGAAATGAANGNCAATCGGATCAATTTTCCATCTAGAAGGGCTGATTAATAATGTGTGGT
GNAAAATATGAAATAGGGATGTGACGCGTCGATTNTGTTGGATGACACCACGAACTTCACTGGGGAGAAGACTGCCGGGGCNAATAACAATTCCATACGGGGATACGAGGTGATTGACAC
GATCAAGTCCCATCTAGAGAGCAGCTGCCCNGGGGTCGTGTCTTGTGCAGACATCTTGGCCATCGCCGCGCGTGATTCTGTTGTT
GCTGTAAGTGCACATTTTCTTCTNAACACTAGCAA
TCAATTGGGAGGAAAAAAAAAAAAAAAACCACTACGGTTTGCCTCAGTAACCACATTTCTAACATGGAAGGGGAATATGAGGGGATTCGAATCCTTATATTCTGAGGAGGTTGAGGTGGA
GACAATTTAGTTTCAAGTGTGGGTTTCGACTCTCACGCCCTGTAAGAAGGCATGACAGAAGTTTAAAAGTGAGAGTTATTGTAAAAATAGAGTAGGATTGACCAAAAAAAAAAAAGAGGA
AAAAATCACATGCTATATTACCTATCTATATTAGTACTAACATGTTTGGATTTATTTGTTTATTTAATTTTCAGTTAGGTGGCCCAAGTTGGACAGTCTTATTAGGAAGAAGAGACTCGA
CCACTGCAAGCCTAACTGATGCTAATAGCAACATTCCTGCCCCAACTTTGAGCCTTAGCGACCTCACCACTTCCTTCTCTAACAAAGGCTTCACTGCCAAAGAAATGGTGGCACTTTCAG
GTCATTATTATTTTTATTTTTTTGCATTTTATAATAAAGAATTATAATAAAGTTTGACTGATATACTATGATCAATTTACAAAAACTGTTCGATTGTTGTTAATAGGATCGCACACGATA
GGTCAAGCCCGATGCACAAGTTTCCGAACCCGGCTTTACAACGAGAACGACATCAACGCCACATTCGCAACGTCACTAAACGCAAACTGCCCAAGCTCCGGAGGTGACAATAATCTCTCT
CCTCTCGACACCACGAGCCCGACGTACTTCGACAATGGCTACTTCAAGAACTTGCAGACCCAAAAGGGGCTTCTTCACTCGGACCAACAATTGTTCAGTGGTGGTTCCACGGACGCTCAA
GTGAACACTTACAGCAGCAATTCGGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGACGATGGGTAACCTCAGCCCGCTCACCGGCTCAAGCGGTCAAATTAGGAAGAATTGCAGG
AAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCTGTCAAACCCGTCTACTTATTGTTGCTGTGTTTCCTCCTCGGAACAGCCTCAGCTCAGCTGTCCAGCACTTTCTACTCCAAATCCTGTCCCAGCGCCCTC
CGCACCATTAAGTCTGGCGTGAGCTCCGCCGTGTTCAGCGAGGCCCGCATGGGCGCATCACTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GGATGTGACGCGTCGATTNTGTTG
GATGACACCACGAACTTCACTGGGGAGAAGACTGCCGGGGCNAATAACAATTCCATACGGGGATACGAGGTGATTGACACGATCAAGTCCCATCTAGAGAGCAGCTGCCCNGGGGTCGTG
TCTTGTGCAGACATCTTGGCCATCGCCGCGCGTGATTCTGTTGTT
TTAGGTGGCCCAAGTTGGACAGTCTTATTAGGAAGAAGAGACTCGACCACTGCAAGCCTAACTGATGCTAATAGC
AACATTCCTGCCCCAACTTTGAGCCTTAGCGACCTCACCACTTCCTTCTCTAACAAAGGCTTCACTGCCAAAGAAATGGTGGCACTTTCAG
GATCGCACACGATAGGTCAAGCCCGATGC
ACAAGTTTCCGAACCCGGCTTTACAACGAGAACGACATCAACGCCACATTCGCAACGTCACTAAACGCAAACTGCCCAAGCTCCGGAGGTGACAATAATCTCTCTCCTCTCGACACCACG
AGCCCGACGTACTTCGACAATGGCTACTTCAAGAACTTGCAGACCCAAAAGGGGCTTCTTCACTCGGACCAACAATTGTTCAGTGGTGGTTCCACGGACGCTCAAGTGAACACTTACAGC
AGCAATTCGGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGACGATGGGTAACCTCAGCCCGCTCACCGGCTCAAGCGGTCAAATTAGGAAGAATTGCAGGAAAGTCAAC

Retrieve as FASTA