Entry information : EguPrx25
Entry ID 11494
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx25
Name EguPrx25
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx25
start..stop
S start..stop
EgrPrx25 608 0 1..319 1..319
EglPrx25 606 0 1..319 1..319
EcamPrx25 598 0 1..319 1..322
EcamPrx24 581 0 1..319 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17904..18119 216 N° 2 19611..19802 192 N° 3 19922..20087 166 N° 4 20192..20574 383
join(17904..18119,19611..19802,19922..20087,20192..20574)


exon

Literature and cross-references EguPrx25
Protein sequence: EguPrx25
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   32972.11 (30365.8) Transmb domain:   %s   i12-34o
PI (pH):   %s   6.64 (6.65) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACENSSPRPAFLLLLCFLLGTASARLSSTFXFTSCPSALHTIKSGVNSXVSSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEKTAGANDNSIRGYEVIDTIKSQLESSCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRDSTTXSLSAANSDIPAPTLSLXDLITAFSNKGXTAKEMVALSGSHTIGQARCTTFQTRLYNESDINSTXATSLKENCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGLLHSDQQLFSGGSTDAQVNTYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_1_745 (17904..20574)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGCGAGAACTCTTCTCCCAGACCCGCCTTCTTATTGTTGCTGTGTTTCCTACTTGGAACAGCCTCGGCTCGGCTGTCCAGCACTTTCTANTTCACATCCTGTCCCAGCGCCCTC
CACACCATTAAGTCCGGCGTGAACTCCGNAGTGTCCAGCGAGGCCCGCATGGGCGCCTCACTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GCAAGTCCCTCTCCTCCGAGTCTC
TCCTCTCTTTCCCATTGATTTCTACCTTTGTTTCTCTTCTGTCATTCAAGCTGCATGCAAGCGTGCGTGCATGATGCATCTTTATGCCTGTGCTTGTGAAACATTCCAACCACCCTCATA
GTCAAAGGCATCATTAGATTNCGCTTCTACGCAATTAATGTACTCTCTTTTTCGCTAATTAAAACAGTAGGTACGAGATTCGCATATTGAATTAGTCGAGTCTGACCGACCTTTTTGGTG
TATTGTTGTGCCATGCATTTTTGTGAGTTTATCAAAGGTGGACAAGAATGTTGTTGTGTATACTCTTAATTTTTTTATTACAGAGACAATATATGCTATAATTTTCTTTATTATAAAAGC
CATGCAGGCGNCGTACTTTATGCTGATCACGCTGTTGATAAGATGTGCATGTATGATTAGCTACCTGTTTTAAACCCGATGAACTCGATGATTTAGATCATGCAAAAGTCCTAAACGTTG
CAGCTGTAAAAAAANAAGAGAGAGANGGCCATGCTTTTNAAGTCAAATACGCNTTTATCACGTTTGGCAAAACCAATCAGTCTTTCTCAATAGGTTTCAATCATATTTTGATCACCATCC
CTTTGGTTGCCATACTTTTCTAAATTTAAAATGATATTTTATGGTAAAATATCAGTTTTAATGGAATTTGTTAATCCAATGGTATTCTAAAAATCATATTAGATCTTTGAATAAATGAAT
TTCGCCTTGTGCATGGCCTCACTAGTTTGCTTCCAACACAAATTTAGAGTGTCAATCTAAATTAACTAATTGATTTAGTGTACCTTCTTTGTGTTCTTTGTGCATAATTTAAGAGTTGCT
TGCATCCTAATGGACCTTTCTCCATCAAACATGCCGTCTCTACTTTGATCTTGATATTCATAGGCTGATCTATTTTTTAAATAACAAATATGACATGTTTACAACTTTCTCGGTTAGATT
TGTGGGTTGCTTTTCTTTTTCNTATATAGGTTGGAAATTGTCTAGATTTTCATTTTTGATCGATACATAATTGGTCATTCGAGAAGGCCAAACTTAGGCTAATTCTAGTGAATCATAAAG
TCGGTGACTCCCCTCTGTTATATATTAAAGAACGCGCCATGTTGCAAACCAAAAATCTTGATTTAGAGAACTCTTCACAGCGCAATCATTTTGTTTCTAGTCCGACGATTATTGGATGCA
TTGTTCCTTGAGAAACNACAGGGANTAAAGTCAAAAGGCATGAGCAAGAGTGTCACCTTCGTCCAGATTGGTGTCTCTAGTCGTTGATAGTGGGGGACAAAAAGGGGGAATGATAAGGGA
AACAACCAGTGTTTATGCTCTCATTTCAGGAAAATTTATAACAACCAAACCTCCTGTCTACAACCAATGAATGAAATGAACGCCAATTGGATCGATTTTCCAACTAGAAGGGCTGATTAA
TAATGTGTGGTGCAAAATATGAAACAGGGATGTGACGCGTCGATTCTGTTGGACGACACCGCGAACTTCACTGGGGAGAAGACCGCCGGCGCGAATGACAATTCCATACGTGGATACGAG
GTGATCGACACGATCAAGTCCCAACTGGAGAGCAGCTGCCCTGGGGTCGTGTCCTGTGCTGACATCTTGGCCGTCGCCGCGCGTGATTCTGTTGTTGCC
GTAAGTGCACATTTTCTTCTC
AACACTAGCAATCAATTGGGAGGAAAAAATCACATGCTATGTTACCTTTCTATATTAGCACTAACATGTTTGGATTTATTTGTTTATTTAATTTTCAGTTAGGTGGCCCAAGTTGGAGAG
TCTTATTAGGAAGAAGAGACTCGACCACCNCAAGCCTAAGTGCTGCTAATAGCGACATTCCTGCCCCAACTTTGAGCCTTAGNGACCTCATCACCGCCTTCTCTAACAAAGGCTTNACTG
CCAAAGAAATGGTGGCACTNTCAG
GTCTTTCTTTTTTTTTTGGTTGCATTTTATAATAAAGAATTATAATAAAGCTCGACTGATATACCAAGATCGATTTACAAAAACTGTTCAATTGTT
GTCAATAGGATCGCACACGATAGGTCAAGCCCGATGCACAACTTTCCAGACNCGGCTTTATAATGAGAGCGACATCAACAGCACGNTCGCAACGTCACTAAAAGAAAACTGCCCAAGCTC
CGGAGGTGACAACAATCTCTCTCCTCTCGACACCACAAGCCCGACGTACTTCGACAACGCCTACTTCAAGAATTTGCAGACCCAAAAGGGGCTTCTTCACTCGGACCAGCAATTGTTCAG
TGGTGGTTCCACAGACGCTCAAGTGAACACTTACAGTAGCAATTCGGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTCAGCCCACTCACCGGCTCAAGCGG
TCAGATTAGGAAGAACTGCAGGAAACTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGCGAGAACTCTTCTCCCAGACCCGCCTTCTTATTGTTGCTGTGTTTCCTACTTGGAACAGCCTCGGCTCGGCTGTCCAGCACTTTCTANTTCACATCCTGTCCCAGCGCCCTC
CACACCATTAAGTCCGGCGTGAACTCCGNAGTGTCCAGCGAGGCCCGCATGGGCGCCTCACTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GGATGTGACGCGTCGATTCTGTTG
GACGACACCGCGAACTTCACTGGGGAGAAGACCGCCGGCGCGAATGACAATTCCATACGTGGATACGAGGTGATCGACACGATCAAGTCCCAACTGGAGAGCAGCTGCCCTGGGGTCGTG
TCCTGTGCTGACATCTTGGCCGTCGCCGCGCGTGATTCTGTTGTTGCC
TTAGGTGGCCCAAGTTGGAGAGTCTTATTAGGAAGAAGAGACTCGACCACCNCAAGCCTAAGTGCTGCTAAT
AGCGACATTCCTGCCCCAACTTTGAGCCTTAGNGACCTCATCACCGCCTTCTCTAACAAAGGCTTNACTGCCAAAGAAATGGTGGCACTNTCAG
GATCGCACACGATAGGTCAAGCCCGA
TGCACAACTTTCCAGACNCGGCTTTATAATGAGAGCGACATCAACAGCACGNTCGCAACGTCACTAAAAGAAAACTGCCCAAGCTCCGGAGGTGACAACAATCTCTCTCCTCTCGACACC
ACAAGCCCGACGTACTTCGACAACGCCTACTTCAAGAATTTGCAGACCCAAAAGGGGCTTCTTCACTCGGACCAGCAATTGTTCAGTGGTGGTTCCACAGACGCTCAAGTGAACACTTAC
AGTAGCAATTCGGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTCAGCCCACTCACCGGCTCAAGCGGTCAGATTAGGAAGAACTGCAGGAAACTCAAC

Retrieve as FASTA