Entry information : EguPrx26
Entry ID 11495
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx26
Name EguPrx26
Class Class III peroxidase    [Orthogroup: Prx134]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx26
start..stop
S start..stop
EgrPrx26 668 0 1..325 1..325
EglPrx26 666 0 1..325 1..325
EcamPrx26 660 0 1..325 1..325
EgrPrx39 476 4e-171 11..325 11..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26926..27153 228 N° 2 27292..27486 195 N° 3 27605..28156 552  
join(26926..27153,27292..27486,27605..28156)


exon

Literature and cross-references EguPrx26
Protein sequence: EguPrx26
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   35373.08 (32999.8)  
PI (pH):   %s   9.24 (9.07) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESKGGNRFLAVLLLSITATALSFPNHHTGLTPYYYNYACPQALPTIRQVVKAAVKKERRMGASLLRLHFHDCFVNGCDASVLLDPTPTIDTEKLAGANNNSARGFEVIDQIKEEVDKVCGRAVVSCADILAVAARDSVVLLGGPWWNVRLGRRDSTTASRTXANTDLPAPFMDLSTLTSSFQKQGLDAKDLVVLSGGHTLGFAQCFTFKDRAHNDSDIHPKFAKKLQSICPRAQSESDSNLAKLDPTSTRFDTLYYKNLLKQKGLLRSDQALFGSGNTDELVRTYSDDATAFWKDFAKSMVKMGNIKPLTGNLGQVRXNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Scaffold_1_745 (26926..28156)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCGAAAGGCGGGAATCGTTTTCTCGCAGTTCTCTTGTTGAGCATCACGGCCACAGCTCTCTCTTTTCCTAATCACCACACTGGCCTCACACCTTACTACTACAACTACGCTTGT
CCTCAAGCTTTGCCGACCATCAGGCAAGTCGTCAAGGCAGCGGTGAAGAAAGAGAGACGCATGGGTGCTTCGTTACTGCGTCTGCACTTCCATGACTGCTTCGTTAAT
GTACGACACATT
GCTTGTCTCTTGAAGTACTTACGTAGCTGTAACCGATTGCGATATAAGTTTTGTTTTTTCTTTTTTGGGGCACGGGGGGTGGGGTTTATGTCTGTTGAATTAACATTGCTCTGACTGACC
GTGCAGGGCTGTGATGCTTCGGTACTTCTAGATCCGACGCCCACCATCGATACCGAAAAGCTCGCCGGCGCAAACAACAATTCTGCTAGAGGTTTCGAAGTGATCGATCAGATCAAGGAG
GAGGTCGACAAAGTCTGTGGCCGTGCGGTGGTCTCTTGCGCAGATATTTTGGCAGTTGCTGCTCGTGACTCCGTCGTTTTG
GTAAGTGGTTGCGCTTGCGTTGAATTTTTAAGTCAATAC
GTGTAACTAATCAATGTAATAGCACATATTTANACAGTGAACTGTTGATGATTTCGATTCTTGGTATTTGGTAATGTAGCTGGGAGGGCCATGGTGGAACGTAAGGCTTGGAAGAAGAGA
CTCGACCACCGCGAGCAGGACGANCGCCAACACGGACCTGCCGGCCCCGTTCATGGACCTAAGCACACTAACTAGCTCGTTCCAAAAACAAGGCCTAGACGCCAAAGACCTGGTCGTTCT
CTCTGGGGGACACACGCTTGGGTTTGCGCAATGCTTTACCTTCAAGGATCGGGCCCATAACGATTCGGACATCCACCCTAAATTCGCAAAGAAGCTCCAATCCATTTGCCCNCGCGCCCA
ATCCGAAAGCGACTCGAACCTNGCTAAGTTGGACCCGACGTCGACGCGCTTCGACACGTTGTACTACAAGAACTTGTTGAAGCAAAAGGGTCTCCTTCGATCAGATCAAGCACTCTTCGG
TAGTGGCAACACCGATGAGTTAGTGAGGACGTACAGCGACGACGCCACTGCATTTTGGAAAGATTTCGCGAAATCGATGGTCAAGATGGGGAATATAAAGCCGTTAACNGGAAATCTTGG
TCAGGTTCGCNATAATTGTAGAAGGGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCGAAAGGCGGGAATCGTTTTCTCGCAGTTCTCTTGTTGAGCATCACGGCCACAGCTCTCTCTTTTCCTAATCACCACACTGGCCTCACACCTTACTACTACAACTACGCTTGT
CCTCAAGCTTTGCCGACCATCAGGCAAGTCGTCAAGGCAGCGGTGAAGAAAGAGAGACGCATGGGTGCTTCGTTACTGCGTCTGCACTTCCATGACTGCTTCGTTAAT
GGCTGTGATGCT
TCGGTACTTCTAGATCCGACGCCCACCATCGATACCGAAAAGCTCGCCGGCGCAAACAACAATTCTGCTAGAGGTTTCGAAGTGATCGATCAGATCAAGGAGGAGGTCGACAAAGTCTGT
GGCCGTGCGGTGGTCTCTTGCGCAGATATTTTGGCAGTTGCTGCTCGTGACTCCGTCGTTTTG
CTGGGAGGGCCATGGTGGAACGTAAGGCTTGGAAGAAGAGACTCGACCACCGCGAGC
AGGACGANCGCCAACACGGACCTGCCGGCCCCGTTCATGGACCTAAGCACACTAACTAGCTCGTTCCAAAAACAAGGCCTAGACGCCAAAGACCTGGTCGTTCTCTCTGGGGGACACACG
CTTGGGTTTGCGCAATGCTTTACCTTCAAGGATCGGGCCCATAACGATTCGGACATCCACCCTAAATTCGCAAAGAAGCTCCAATCCATTTGCCCNCGCGCCCAATCCGAAAGCGACTCG
AACCTNGCTAAGTTGGACCCGACGTCGACGCGCTTCGACACGTTGTACTACAAGAACTTGTTGAAGCAAAAGGGTCTCCTTCGATCAGATCAAGCACTCTTCGGTAGTGGCAACACCGAT
GAGTTAGTGAGGACGTACAGCGACGACGCCACTGCATTTTGGAAAGATTTCGCGAAATCGATGGTCAAGATGGGGAATATAAAGCCGTTAACNGGAAATCTTGGTCAGGTTCGCNATAAT
TGTAGAAGGGTGAAT

Retrieve as FASTA