Entry information : EguPrx29
Entry ID 11497
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: EguPrx29
Name EguPrx29
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx29
start..stop
S start..stop
EglPrx29 644 0 1..322 1..322
EgrPrx29 605 0 1..322 1..322
EcamPrx25 577 0 1..322 1..322
EgrPrx25 574 0 1..322 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2855..3079 225 N° 2 4573..4764 192 N° 3 4884..5049 166 N° 4 5154..5536 383
join(2855..3079,4573..4764,4884..5049,5154..5536)


exon

Literature and cross-references EguPrx29
Protein sequence: EguPrx29
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (294)
PWM (Da):   %s   33669.25 (30906.8) Transmb domain:   %s   i13-35o
PI (pH):   %s   6.49 (6.23) Peptide Signal:   %s   cut: 29 range:29-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACENSSPRXXRPAFLLLLCFLLGTASARLSXTFYSTSCPSALHTIKSGVSSAVSSEXRMDGSLLRLHFHDCFVNGCDASILLDDTMNFTGEKTADANDNSIHGYEVIDTIKSQLESSCPGVVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTASLSAANSDLPASTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQARCTTFRTRLYNESDINSMYATSLKANCQSSGGDNNLSPLDTMSPTYFDNAYFKNLQTQKGLLHSDQQLFSGGSTDXQVNMYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_1_746 (2855..5536)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGCGAGAACTCTTCTCCCAGACNNNCCAGACCCGCCTTCTTATTGTTGCTGTGTTTCCTACTTGGAACAGCCTCGGCTCGGCTGTCCAGNACTTTCTACTCCACATCCTGTCCC
AGCGCCCTCCACACCATTAAGTCCGGCGTGAGCTCCGCAGTGTCCAGCGAGNCCCGCATGGACGGGTCGCTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GCAAGTCCCTCTCCT
NCGAGTCTCTTCTCTCTTTCACATTGATTTCTACCTTTGTTTGTCTTCTGTCGTTCAAGCTGCATGCAAGCGTGCGTGCATGATGCATCTTTATGCCTGTGCTTGTGAAACATTCCAGCC
ACCCTCATAGTCAAAGGCATCATTAGATTTCGCTTCTACGCATTAATGTACGCTCTTTTTCGCTAACCAAAACAGTNGGTACGAGATTCGCATAATGAATTAGTCGAGTCTGACTGACCT
TTTTGGTATATTGTTGGGCCATGCATTTTTGTGAGTTTACCAAGGGTGGACAAGAATGTTGTTGTGTATACTCTAATTTTTTTTATTACACAGACAATATATNCTATATTTTTCTCTATT
ATAAAACCATGCAGGCGAACGTACTTTATGCTGATCATGCTGTTGATAAGATGTGCGTGTATGATTAGCNACCTGTTTTAAACCCGATGAACTCGATGATTTAGATCATGCAAAGGTCCT
AAACGTTGCAGCTGGAAANAGAGAGAGAGAGACGGCCATGCTTTTTAAGTCAAATAGGCGTTTATCACGTTTGGCAAAACCAATCAGTCTTCCTCAATAGGTTTCAATCATATTTTGATC
ACCATCCCTTTGGTTGCCATGCTTTTCTAAATTTAAAATGATATTTTATGGTAAAATATCAGTTTTAATGGAATTTCTTAATCCAATGGTATTCTAAAAATCATATTAGATCTTTGAATA
AATGAATTGCACCTTGTGCATGGCCTCACTAGTTTGCTTCCAACACAAATTTAGAGTGTCAATCTAAATTAACTAATTGATTTAGTGTACCTTCTTTGTGTTNGTTGTGCATAATTTAAG
AGTTGCCTGCATCCTAATGGACCTTTCTCCATCAANCATGCCGTCTCTACTTTGATCTTGNTANTNAAAGGCTGATCGATTTTTTAAATAACAAATATGACATGTTTACANNNTTCTCGA
TTAGATTTGTGGGTTGCTTTTCTTTTTCCTATATAGGTTGGAAATCATCTAGATTTTCATTCTTAATTGATACATAATTAGTCATTCGAGAAGGCCAAGCTCAGGCTAATTCTAGTGAAT
CATAAAGTCGGTTACTCCCCTCTGTTAAATATTAAAGAACGTGCCATGTTGCTAACCAAAAATCTTGATTTAGAGAACACTTCACAGCGCAATCATTTTGTNTCTAGTCCGACGATTATT
GGATGCATTGTTCCATGAGAAACAACTCGGAGTAAAGTCAAAAGGCATNAGAAAGAGTGTCACCCCCGTCCAAACTGGTGTCTCAAGTCGTTCATAGTAGGGGACAAAAAGGGGGAATGA
TAAGGGAAACAACCAGTGTTTATGCTCTAATTTCAGGAAAATTTACAACACCCAAACCTCCTGTCTCCAACCAACCAATGAATGAAATGAACGCCAATCGGATCGATTTTCCAACTAGAA
TGGCTGNTTAANAATGTGTGGTGCAAAATATGAAACAGGGATGTGACGCGTCGATTTTGTTGGATGACACCATGAACTTCACCGGGGAGAAGACCGCCGACGCGAATGACAATTCCATAC
ATGGATACGAGGTGATCGACACAATCAAGTCCCAACTGGAGAGCAGCTGCCCTGGGGTCGTGTCCTGTGCTGACATCTTGGCCGTCGCCGCGCGTGATTCTGTTGTTGCC
GTAAGTGCAC
ATTTTCTTCTCAACACTAGCGATNAATTGGGAGGAAAAAATCACATGCTATGTTACCTTTCTATNTTAGCACTAACATGTTTGGATTTATTTGTTTATTTAATTTTCAGTTAGGTGGCCC
AAGTTGGACAGTCTTATTAGGAAGAAGAGACTCGACCACCGCAAGCCTAAGTGCTGCTAATAGCGACCTTCCTGCCTCAACTTTGAGCCTTAGCGACCTCATCACCGCCTTCTCTAACAA
AGGCTTCACTGCCAAAGAAATGGTGGCACTTTCAG
GTCTTCATTTTTTTTTTTNTTGCATTTTATAATAAAGAATTATAATAAAGCTCGACTGATTTACTAAGATCGATTTACAAAAACT
GTTCAATTGTTGTCAATAGGATCGCACACGATAGGTCAAGCCCGATGCACAACTTTCCGGACCCGACTTTATAATGAGAGCGACATCAACAGCATGTACGCAACGTCACTAAAAGCAAAC
TGCCAGAGCTCCGGAGGTGACAACAATCTCTCTCCTCTCGACACCATGAGCCCGACATACTTTGACAACGCCTACTTCAAGAACTTGCAGACCCAAAAGGGGCTTCTTCACTCGGACCAG
CAATTGTTCAGTGGTGGTTCCACGGACGNTCAAGTGAACATGTACAGTAGCAATTCGGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTCAGCCCACTCACC
GGCTCAAGCGGTCAGATTAGGAAGAACTGCAGGAAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGCGAGAACTCTTCTCCCAGACNNNCCAGACCCGCCTTCTTATTGTTGCTGTGTTTCCTACTTGGAACAGCCTCGGCTCGGCTGTCCAGNACTTTCTACTCCACATCCTGTCCC
AGCGCCCTCCACACCATTAAGTCCGGCGTGAGCTCCGCAGTGTCCAGCGAGNCCCGCATGGACGGGTCGCTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GGATGTGACGCGTCG
ATTTTGTTGGATGACACCATGAACTTCACCGGGGAGAAGACCGCCGACGCGAATGACAATTCCATACATGGATACGAGGTGATCGACACAATCAAGTCCCAACTGGAGAGCAGCTGCCCT
GGGGTCGTGTCCTGTGCTGACATCTTGGCCGTCGCCGCGCGTGATTCTGTTGTTGCC
TTAGGTGGCCCAAGTTGGACAGTCTTATTAGGAAGAAGAGACTCGACCACCGCAAGCCTAAGT
GCTGCTAATAGCGACCTTCCTGCCTCAACTTTGAGCCTTAGCGACCTCATCACCGCCTTCTCTAACAAAGGCTTCACTGCCAAAGAAATGGTGGCACTTTCAG
GATCGCACACGATAGGT
CAAGCCCGATGCACAACTTTCCGGACCCGACTTTATAATGAGAGCGACATCAACAGCATGTACGCAACGTCACTAAAAGCAAACTGCCAGAGCTCCGGAGGTGACAACAATCTCTCTCCT
CTCGACACCATGAGCCCGACATACTTTGACAACGCCTACTTCAAGAACTTGCAGACCCAAAAGGGGCTTCTTCACTCGGACCAGCAATTGTTCAGTGGTGGTTCCACGGACGNTCAAGTG
AACATGTACAGTAGCAATTCGGCTACTTTCATGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTCAGCCCACTCACCGGCTCAAGCGGTCAGATTAGGAAGAACTGCAGGAAA
GTCAAC

Retrieve as FASTA