Entry information : EguPrx32
Entry ID 11499
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-11 (Christophe Dunand)
Peroxidase information: EguPrx32
Name EguPrx32
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx32
start..stop
S start..stop
EglPrx32 657 0 1..323 1..323
EgrPrx32 655 0 1..323 1..323
EgrPrx41 591 0 6..323 4..321
EgrPrx38 590 0 3..323 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7672..7899 228 N° 2 7359..7553 195 N° 3 6677..7222 546  
complement(join(6677..7222,7359..7553,7672..7899))


exon

Literature and cross-references EguPrx32
Protein sequence: EguPrx32
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   35196.87 (32904.6)  
PI (pH):   %s   8.89 (8.72) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALGSLSLFRALLFLSLTASXLSTRPYKNGLSPDFYDYVCPQALPTIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDGSILXDPTPTIDSEKLAFPNNNSARGFEVIDQIKAEVDRVCGRPVVSCADILAVTARDSVVALGGPSWKVRLGRRDSMTASRTTANSDIPAPNMDLPALINNFKRQGLKVKDLVALSGAHTIGFAQCRVFRDRIYNDSNINHAFAKNLQSSCPRTGSDTNLASLDPSPARFDTLYYNNLLTQKGLLHSDQALSTDESTXELVKSYSYDYDAFWKDFAKSMVRMGNIKPLIGNQGQIRSNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
scaffold_1_750 (7899..6677)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTAGGTAGCCTCAGCCTCTTTCGAGCACTTCTCTTCTTGTCCCTCACGGCCTCGNCTCTCTCGACGCGCCCCTACAAGAATGGTCTCTCGCCAGACTTCTACGACTATGTCTGC
CCTCAAGCCTTGCCCACCATCAAGCGTGTCGTCGAGGCAGCGGTGCAGCAAGAAAGACGCATGGGCGCTTCCTTGCTGCGCTTGCACTTCCACGATTGTTTCGTCAAT
GTAAGACATATA
CGGCTAAATTTCACGCTAATTTGTTGTTCTAAAAAATAGTGATTTCTATTTAGCAGTGCACAATATTTGCTGAACATTATGTATGTTTGGGCGTTGAATGATGCAGGGTTGTGATGGGTC
GATACTTNTGGATCCAACCCCAACCATCGACAGCGAAAAGCTTGCGTTTCCNAATAACAATTCAGCTAGAGGATTCGAAGTGATCGACCAAATTAAGGCAGAGGTTGACAGAGTATGCGG
ACGTCCNGTGGTATCTTGTGCGGACATCTTGGCTGTCACTGCTCGTGACTCCGTTGTTGCG
GTACGTCTAGTTTTACTACGTCCAATGATGNTTAATTAGCAANTCTGAATTTAGACTCA
TCATANGCTTAGTTGGCTTTTTTGTGCCTTAAGACATTGCCAATCTGAACTAGGCGCTATACTTCATTCAATTTCAGTTAGGGGGGCCTTCGTGGAAAGTACGACTTGGACGAAGAGACT
CGATGACGGCNAGCAGGACAACGGCAAACAGCGACATTCCTGCGCCAAACATGGACTTACCTGCCTTAATTAACAATTTCAAGAGACAAGGTCTTAAGGTCAAGGACTTGGTTGCACTAA
GCGGTGCTCACACGATTGGCTTCGCACAGTGCCGTGTTTTCAGGGACAGGATATACAATGACAGCAACATCAACCACGCTTTTGCGAAGAACCTCCAGTCCTCCTGCCCACGCACGGGAA
GCGACACAAACCTTGCAAGTTTAGATCCATCGCCGGCNCGNTTTGACACGTTGTACTACAATAACCTGTTGACCCAGAAGGGNCTTCTTCACTCTGATCAGGCACTTTCAACTGATGAAT
CCACANTTGAGCTAGTGAAGAGTTATAGCTACGATTATGATGCATTCTGGAAGGATTTCGCTAAATCGATGGTCAGAATGGGAAACATCAAGCCGTTGATCGGCAACCAAGGTCAAATCC
GCTCAAACTGCCGGAGAGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTAGGTAGCCTCAGCCTCTTTCGAGCACTTCTCTTCTTGTCCCTCACGGCCTCGNCTCTCTCGACGCGCCCCTACAAGAATGGTCTCTCGCCAGACTTCTACGACTATGTCTGC
CCTCAAGCCTTGCCCACCATCAAGCGTGTCGTCGAGGCAGCGGTGCAGCAAGAAAGACGCATGGGCGCTTCCTTGCTGCGCTTGCACTTCCACGATTGTTTCGTCAAT
GGTTGTGATGGG
TCGATACTTNTGGATCCAACCCCAACCATCGACAGCGAAAAGCTTGCGTTTCCNAATAACAATTCAGCTAGAGGATTCGAAGTGATCGACCAAATTAAGGCAGAGGTTGACAGAGTATGC
GGACGTCCNGTGGTATCTTGTGCGGACATCTTGGCTGTCACTGCTCGTGACTCCGTTGTTGCG
TTAGGGGGGCCTTCGTGGAAAGTACGACTTGGACGAAGAGACTCGATGACGGCNAGC
AGGACAACGGCAAACAGCGACATTCCTGCGCCAAACATGGACTTACCTGCCTTAATTAACAATTTCAAGAGACAAGGTCTTAAGGTCAAGGACTTGGTTGCACTAAGCGGTGCTCACACG
ATTGGCTTCGCACAGTGCCGTGTTTTCAGGGACAGGATATACAATGACAGCAACATCAACCACGCTTTTGCGAAGAACCTCCAGTCCTCCTGCCCACGCACGGGAAGCGACACAAACCTT
GCAAGTTTAGATCCATCGCCGGCNCGNTTTGACACGTTGTACTACAATAACCTGTTGACCCAGAAGGGNCTTCTTCACTCTGATCAGGCACTTTCAACTGATGAATCCACANTTGAGCTA
GTGAAGAGTTATAGCTACGATTATGATGCATTCTGGAAGGATTTCGCTAAATCGATGGTCAGAATGGGAAACATCAAGCCGTTGATCGGCAACCAAGGTCAAATCCGCTCAAACTGCCGG
AGAGTGAAT

Retrieve as FASTA