Entry information : AtPrx22 (At2g38380 / PER22 / AtperoxP22 / ATPEa / BasicperoxidaseE / Athpreca / prxEa)
Entry ID 115
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx22 (At2g38380 / PER22 / AtperoxP22 / ATPEa / BasicperoxidaseE / Athpreca / prxEa)
Name (synonym) AtPrx22 (At2g38380 / PER22 / AtperoxP22 / ATPEa / BasicperoxidaseE / Athpreca / prxEa)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Flowers
Green siliques
Leaves
Mixed tissues
Roots
Rosettes
Seeds
Siliques
Inducers Dark growth
Drought
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx22
start..stop
S start..stop
AhalPrx38 689 0 1..349 1..349
AlyPrx22 685 0 1..349 1..349
AtPrx23 637 0 1..349 1..349
AlyPrx23 635 0 1..349 1..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16076443..16076670 228 N° 2 16076812..16077003 192 N° 3 16077085..16077253 169 N° 4 16077854..16078314 461
join(16076443..16076670,16076812..16077003,16077085..16077253,16077854..16078314 )


exon

Literature and cross-references AtPrx22 (At2g38380 / PER22 / AtperoxP22 / ATPEa / BasicperoxidaseE / Athpreca / prxEa)
Literature REFERENCE 1 Kim BH, Kim SY, Nam KH. Genes encoding plant-specific class III peroxidases are responsible for increased cold tolerance of the brassinosteroid-insensitive 1 mutant. Mol Cells. 2012 Dec;34(6):539-48.
Protein ref. UniProtKB:   P24102
DNA ref. Phytozome 11:   Chr2 (16076443..16078314)
mRNA ref. GenBank:   NM_129394
Cluster/Prediction ref. Phytozome Gene 11:   19638191 UniGene:   At.312
Omic ref. AtProteome:   At2g38380 ATTED-II:   At2g38380 e-FP Browser:   At2g38380 ePlant:   At2g38380 Genevestigator:   At2g38380 TAIR:   At2g38380
Protein sequence: AtPrx22 (At2g38380 / PER22 / AtperoxP22 / ATPEa / BasicperoxidaseE / Athpreca / prxEa)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (320)
PWM (Da):   %s   37971.06 (35117.7)  
PI (pH):   %s   5.76 (5.77) Peptide Signal:   %s   cut: 30 range:30-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFSPSFSCSAIGALILGCLLLQASNSNAQLRPDFYFGTCPFVFDIIGNIIVDELQTDPRIAASLLRLHFHDCFVRGCDASILLDNSTSFRTEKDAAPNANSARGFNVIDRMKVALERACPGRVSCADILTIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFFNLTQLKTAFADVGLNRTSDLVALSGGHTFGRAQCQFVTPRLYNFNGTNSPDPSLNPTYLVELRRLCPQNGNGTVLVNFDVVTPDAFDSQYYTNLRNGKGLIQSDQELFSTPGADTIPLVNQYSSDMSVFFRAFIDAMIRMGNLRPLTGTQGEIRQNCRVVNPRIRVVENDDGVVSSI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns), 6 cDNA and 133 ESTs. 91 are coming from roots.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAGGAATAA CCTTTAAACG GCTAAAACTA TCTGAATGTT TTGATATTTT ATCAGATTGT TAAAAAGTGA TCAAAAAAAA ACAAAGCAAT ATATTTATCT TCACATGCCT ATTCAATTTA  AGTGACGTGT TGTTATTTAT CACAATTAAC TGACAGAATT TTGTAAAACG TTACCATGTG ACTGTTTTTT TTTTTTTCTT ATCACAAACA GAAAATTATT TCCGTTCCAA TCTTTCTTGC  CATGGAAGAA GCTATGTTAG AAAATGAGCT CTAGCTTACC GGTAATAGGG AAACCAGTCT TGACAACCAT CGAGAAGAGG GTGACAACGA TACATGAGCG ATGGATAGCA CATAAGAATA  AAATGATGAA GGGTTCAAGC AAAAAAAAAC TTGGTAAGAG TTTGAACCCA AAACATCAGA TTTGTCATCT TTTAGGTGAG ACAAAAAAGT CTTGATAACA ATGTGTGCCG GACACAGTTT  TTTTATCTAG AAGATTAAAC TTTGATTTTT CTCACCTAAA AGGTGACAAT AAAGTGAGCT ATGTAGAGTG TCGTCAATTA TTTGTCCATC TTCTTGTTTG TTTTTTTAAT TTCTTCTTTT  TGTCCAACCA TTAGACTAAT ATTTTCATTT TGTTTCTTTC TCTTTTGTCT TCGCTTTCAT CTTGTTTTCA GGAATGACTA ATGCATTCGA ATGTTTTTTC TTTTCCTTTT ATGTGCATTC  CTACTTTATG AAACAATTAG TTTTCAATTC AATTTCGGTG ATAGTTTTAG CCATTTCTGT CCACTTTGGT TGTCTTAGTT AGTTTATTGA TGAGAAGAAA AGACAAGGAG CAAAAGTATT  AGATTAGGTT AACCAAAAAG TCTAGCATAT GGACTCGTAT GAAATTGATA TTTGTATGTA TTAGGTAACT TTGTTTTCTC AGAGATTATT GAGCAAAATG TTTATAATTT ATCGATTAGT  GAAGGTGGCT TCGGAGGCTA CATTTGCGTT ATTTACGGGA AATGGAAGGA CAAAACACAA GTGCTTTCTA GTTTGAAAAT AAAATCAAAG AAATATTGGT TAAAATAGAA CACACTTTAT  AATCACTGAT CACATAATAT TACATTATTA TGACTTATAC GATTTACAAA AACAATTCAG GTCAAAGGCA CTCGTCGATA TAACATAAAG TTGGACATTG AAACTGAGAA TACGTTGGCG  TTCGCGGATT TAACATATAT TTTTTTGTCC ATATTTTTAT ACCGTATCGT CTCAACAATT CTATCATCAA CAAGAACATG TCACTGATAA AAACATGTTT ATCGCAGCAT GATGATATTA  TACATAGACA TATCTTACGT TTAACATGAA TCAACAACCA TATCTTTAGC GACCCTACAC GAATTCAAAT TTGATATCAA TTTCGTACAA TTTCTATCTT ACTACTTTGA AATTTGTGTC  GTTTATAATT ATTTATCAAA CTCAATGATG CGTATTCTAT TCTCAGAAGG AGTCATGTAT GTCTTGAAAT AAATCTAGAA AGAAGTATAG GCGAAATTGA GAACCATCTC TTCATAGAAC  TATACGTCGA TTCATAGTAA GTAAAAAGTC TACATCTGCA ATAAAAATGT ATGGAGTTAG CTAGTTTTGA AAAATACTAT ATACAATTGA AGTGAACATG AAAATCTTAA TTGTTTAATT  AAAGCGCGCG AAAAAACACA ATAATAAGTT AAATTATGTG CACATAATAG ATAGCATTGT CAAAAGGATC GGTTAATTTA TGATTTCACT AATTTTTATT ATCCTTCAAC CACTCTAGTA  AAATACATAT TGCCTTAAAA CAAAACCTAC TAGTCTTAAA ACGAAAAAAG AAAAAAAAAA AAAAAAAAAC TCAATACCTA ATAATCAAAA ATAGTACTCA AGCTTCCCTA TATAATGTTC 
CTTCTTGGCT TTAGCTAATT CACCATATAC CCACACTCAC AAGTCACAAC TCAAATAATC TTTGTCTTCC TCCTACAAAT 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTATGCATGT TGCCATGTTG GGGATATATA TATGGATATG TAAGAAAGTA TAAAATGCGC ACGTGAGAAC AATTTCGACT AATAAAAGTT TTCACGAGTT ATGAGATTTA TGAAATTGGT  ATTAAGTACA CTTACAATGC ATATATACGT GGTGTTTATA ACACTTCAAT TTCTGACATG TATTCAAGTA GCTTTTGATT TAACATCACG TCGAAATTTA TAATATATAT TCAAGCAAAT  TGTTGAAATA AAATGTCCTA GTTTTTGTCA GCTTTCGTTA CTTATAAATG AGAAGAAAAG ACAAGGAGCT AAACTGCTAA AGTATTAGAT TAGGTTAACT TTTGTTAACC ACAAAATCTA  GCACATGGAC GCGTATGAAG TTGATAAATC ATATATGTAT TAGGTAACAT TGTTATTTCA GATTAAATTG TTTTGAGCAA GAATTGTATA AAAAGTTTAT CGATTTGTGA AGGTGGCTTC  TGAGGCTACA TTTGCGGGAT TCACGGGGAA GAGAAGGACA AAACATAAGG AATTCTATTT TTCATAAAAT ATTAATTAGG AAGATAGTTT GAAAATGTTT GCCAATTAGG AAGGACAATC  CTTTTAGAAG GTTTTCCGAG ATTTTTTTTT TTGTCTTGTA TCCAATTATA AATGTACGTA CCTCGTGTAT AAATTAAAAA AAAAAAAGTT TAAACATTCC TTTGAAACTA CAACAAACTC  ATTTATACAA ATATCCGTCC CCTCAAAAAT TCAGATATAT CAACAAGAAC ACGTCACAAA TAAAACGTAA TTATGGTAAC ATGATGATAT TATATTTTCC TACATAGACA TAACTTGTGT  CTAACATGAA TCAACAAACA TATCTTTTAC GACCCTACAT AATCCAAAAT TGATATCAAA TATCGTACTA ATTTCATTTT CCGTACCACT GTTGAAATTT GTGTCGTTTA TAAATTATTT 
ATCAAACTTG AAAAATATCT AAGAATAAGA ATATATTGGC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTTCTCCTTCATTTTCTTGCAGTGCTATTGGAGCCCTAATTTTGGGTTGCCTTCTGCTTCAAGCATCAAACTCTAATGCTCAGTTGAGGCCTGATTTCTACTTCGGGACGTGC
CCATTTGTTTTTGATATCATTGGAAATATCATCGTCGATGAACTGCAGACTGATCCTCGTATTGCCGCGAGCCTCCTTCGTCTTCACTTTCACGACTGCTTTGTTCGT
GTAAGGATTTTC
TCAACTTATCTTTTATTAGTAAAAAATTCAGAACGTGTTCAATGGACAAAACTACTTTATATACCATTTACATATAGAATTTGCTAAAAGCCTTTTTTTTTTTTAATGTAAAATATATGG
TTTTTGTAGGGTTGTGATGCATCGATCTTGCTTGACAATTCCACATCATTCCGGACTGAGAAAGATGCTGCTCCGAACGCAAATTCGGCTCGAGGGTTTAATGTCATAGATAGAATGAAA
GTAGCCCTTGAGAGAGCTTGCCCAGGAAGAGTCTCTTGTGCAGATATTCTCACCATCGCCTCTCAAATATCAGTGCTTTTG
GTATATAAATATACATACATGACGTATCTTTTATTAAAC
TAATCGAAAATGTTATCAATTAAAAGTCTATGTTTTATATAGTCGGGAGGTCCATGGTGGCCGGTTCCGTTGGGGAGGAGAGACAGTGTAGAAGCTTTCTTCGCTCTGGCTAATACAGCT
CTGCCCTCTCCGTTTTTCAATCTTACTCAACTTAAAACAGCCTTTGCTGACGTTGGCCTAAACCGCACTTCCGATCTAGTTGCTCTTTCCG
GTAAAAAAATTCATGTTACATCATCTAAC
TCTAATTAAGATATGCATGTGTTTAAAATGCAATTCCTTTTTATATATTGATAGCTAGCTAAGCTAGACAGACACATTCCTAGACTAAGTCTAGAATTTACATAGTAATTTGTAAGTAAT
AAAATTACAATGTTAACTCAATGTTTTAGATTATTTTGTTAGAGTGATCTACAAAATTTACTTTTTATGTATTTTTTTTCTTTCTTATAGATATGATTTGGTTTGAGCTTTGAAATTGTC
TTATAATATTTAAGGGTTTTATTTTTCTACAATGTTTGAGTTCGAATTTTAGCAATATTTATTTATTAGAAAGTTTTTGAAGGTATATGAATTAGTTAACATGAGTTAAAGATAGAAAAA
CATTTTCTTGGAATACATGACCAAATAGCTGTTAAGAAAAACATGACCGAATGTAAATGAAAAAAAGAAAGAAAATCTAATCAAATACAAATCATCTAGCACGTGATTTTTCAATTTTAA
CTGAGTTGGTAAACGACAAATCATGTTTATCTTTAAATAAAATCACTAATTCCATTTATCTAAACCTTAATGTTTTGTCAAAACGTTTTAGGTGGTCACACATTTGGAAGAGCACAATGC
CAGTTCGTGACGCCTCGTCTCTACAACTTCAATGGTACAAACAGTCCAGACCCAAGTCTGAACCCAACTTACCTTGTCGAACTCCGTCGATTGTGTCCTCAAAACGGAAACGGCACCGTT
CTGGTCAACTTCGATGTCGTGACTCCAGATGCTTTCGATAGTCAATACTACACCAACCTTCGTAATGGGAAAGGTCTTATTCAGAGTGACCAGGAACTCTTTTCGACTCCAGGAGCCGAT
ACGATCCCTTTAGTAAACCAATACAGCAGCGACATGTCCGTGTTCTTTCGAGCATTCATTGACGCAATGATTAGGATGGGAAATCTTAGACCTTTGACTGGAACTCAAGGAGAGATTAGA
CAAAATTGTAGGGTTGTGAATCCACGAATTAGGGTTGTGGAGAACGACGATGGTGTTGTGAGTTCTATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTTCTCCTTCATTTTCTTGCAGTGCTATTGGAGCCCTAATTTTGGGTTGCCTTCTGCTTCAAGCATCAAACTCTAATGCTCAGTTGAGGCCTGATTTCTACTTCGGGACGTGC
CCATTTGTTTTTGATATCATTGGAAATATCATCGTCGATGAACTGCAGACTGATCCTCGTATTGCCGCGAGCCTCCTTCGTCTTCACTTTCACGACTGCTTTGTTCGT
GGTTGTGATGCA
TCGATCTTGCTTGACAATTCCACATCATTCCGGACTGAGAAAGATGCTGCTCCGAACGCAAATTCGGCTCGAGGGTTTAATGTCATAGATAGAATGAAAGTAGCCCTTGAGAGAGCTTGC
CCAGGAAGAGTCTCTTGTGCAGATATTCTCACCATCGCCTCTCAAATATCAGTGCTTTTG
TCGGGAGGTCCATGGTGGCCGGTTCCGTTGGGGAGGAGAGACAGTGTAGAAGCTTTCTTC
GCTCTGGCTAATACAGCTCTGCCCTCTCCGTTTTTCAATCTTACTCAACTTAAAACAGCCTTTGCTGACGTTGGCCTAAACCGCACTTCCGATCTAGTTGCTCTTTCCG
GTGGTCACACA
TTTGGAAGAGCACAATGCCAGTTCGTGACGCCTCGTCTCTACAACTTCAATGGTACAAACAGTCCAGACCCAAGTCTGAACCCAACTTACCTTGTCGAACTCCGTCGATTGTGTCCTCAA
AACGGAAACGGCACCGTTCTGGTCAACTTCGATGTCGTGACTCCAGATGCTTTCGATAGTCAATACTACACCAACCTTCGTAATGGGAAAGGTCTTATTCAGAGTGACCAGGAACTCTTT
TCGACTCCAGGAGCCGATACGATCCCTTTAGTAAACCAATACAGCAGCGACATGTCCGTGTTCTTTCGAGCATTCATTGACGCAATGATTAGGATGGGAAATCTTAGACCTTTGACTGGA
ACTCAAGGAGAGATTAGACAAAATTGTAGGGTTGTGAATCCACGAATTAGGGTTGTGGAGAACGACGATGGTGTTGTGAGTTCTATCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACCATATACC CACACTCACA AGTCACAACT CAAATAATCT TTGTCTTCCT CCTACAAATA TGGGGTTTTC TCCTTCATTT TCTTGCAGTG CTATTGGAGC CCTAATTTTG GGTTGCCTTC  TGCTTCAAGC ATCAAACTCT AATGCTCAGT TGAGGCCTGA TTTCTACTTC GGGACGTGCC CATTTGTTTT TGATATCATT GGAAATATCA TCGTCGATGA ACTGCAGACT GATCCTCGTA  TTGCCGCGAG CCTCCTTCGT CTTCACTTTC ACGACTGCTT TGTTCGTGGT TGTGATGCAT CGATCTTGCT TGACAATTCC ACATCATTCC GGACTGAGAA AGATGCTGCT CCGAACGCAA  ATTCGGCTCG AGGGTTTAAT GTCATAGATA GAATGAAAGT AGCCCTTGAG AGAGCTTGCC CAGGAAGAGT CTCTTGTGCA GATATTCTCA CCATCGCCTC TCAAATATCA GTGCTTTTGT  CGGGAGGTCC ATGGTGGCCG GTTCCGTTGG GGAGGAGAGA CAGTGTAGAA GCTTTCTTCG CTCTGGCTAA TACAGCTCTG CCCTCTCCGT TTTTCAATCT TACTCAACTT AAAACAGCCT  TTGCTGACGT TGGCCTAAAC CGCACTTCCG ATCTAGTTGC TCTTTCCGGT GGTCACACAT TTGGAAGAGC ACAATGCCAG TTCGTGACGC CTCGTCTCTA CAACTTCAAT GGTACAAACA  GTCCAGACCC AAGTCTGAAC CCAACTTACC TTGTCGAACT CCGTCGATTG TGTCCTCAAA ACGGAAACGG CACCGTTCTG GTCAACTTCG ATGTCGTGAC TCCAGATGCT TTCGATAGTC  AATACTACAC CAACCTTCGT AATGGGAAAG GTCTTATTCA GAGTGACCAG GAACTCTTTT CGACTCCAGG AGCCGATACG ATCCCTTTAG TAAACCAATA CAGCAGCGAC ATGTCCGTGT  TCTTTCGAGC ATTCATTGAC GCAATGATTA GGATGGGAAA TCTTAGACCT TTGACTGGAA CTCAAGGAGA GATTAGACAA AATTGTAGGG TTGTGAATCC ACGAATTAGG GTTGTGGAGA  ACGACGATGG TGTTGTGAGT TCTATCTGAT TATGCATGTT GCCATGTTGG GGATATATAT ATGGATATGT AAGAAAGTAT AAAATGCGCA CGTGAGAACA ATTTCGACTA ATAAAAGTTT  TCACGAGTTA TGAGATTTAT GAAATTGGTA TTAAGTACAC TTACAATGCA TATATACGTG GTGTTTATAA CACTTCAATT TCTGACATGT ATTCAAGTAG CTTTTGATTT AACATCACGT 
CGAAATTTAT AATATATATT CAAGCAAATT GTTGAAATAA AATGTCCTAG TTTTTGTC 

Retrieve as FASTA