Entry information : EguPrx33
Entry ID 11500
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-11 (Christophe Dunand)
Peroxidase information: EguPrx33
Name EguPrx33
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx33
start..stop
S start..stop
EguPrx36 662 0 1..323 1..323
EgrPrx33 653 0 1..323 1..323
EgrPrx36 651 0 1..323 1..323
EgrPrx39 650 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11732..11959 228 N° 2 11439..11633 195 N° 3 10708..11253 546  
complement(join(10708..11253,11439..11633,11732..11959))


exon

Literature and cross-references EguPrx33
Protein sequence: EguPrx33
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   34810.48 (32432.2)  
PI (pH):   %s   5.68 (5.68) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALNSLSLVQALLFLSLATSAFSTRPYKEGLTPYFYDYVCPQALPAIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDASILLDPTPTIDSEKLAVPNNNSARGFEVIDQIKAEVDKACGYSLVSXADXLAVAARDSVVALGGPSWEVQLGRRDSTTASRTTANSDIPAPNMDLPALINTFQKQGLDTRDLVALSGAHTIGFAQCVNFRNRTYNDDNIATSFARSLRSLCPRTGEDGNLAGLDPSPAQFDALYFHNLLAQKGLLHSDQALYSGGSTDELVKTYSDDAEAFWDDFAKSMIKMGNIKPLIGNQGQIRSNCRRLN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
scaffold_1_750 (11959..10708)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTAAATAGCCTCAGCCTCGTCCAAGCACTTCTCTTCTTGTCTCTCGCGACCTCGGCTTTCTCGACGCGGCCCTACAAGGAAGGCCTCACGCCATACTTCTACGACTACGTTTGC
CCTCAAGCCTTGCCCGCCATCAAACGCGTTGTCGAGGCAGCGGTGCAACAGGAGCGACGCATGGGCGCTTCGTTACTCCGTTTGCACTTCCACGATTGTTTCGTTAAC
GTACGACACATT
CACGATAGTCTTGATTCGCATTGGTTATCTAGCAGCCGGCATAAATTTGCTAACTTGATTCTTGTTTTGTCCACGTCATAATGTAGGGTTGCGATGCTTCAATACTTTTGGATCCGACCC
CNACCATTGACAGCGAAAAGCTCGCAGTCCCGAATAACAATTCGGCTAGAGGGTTCGAAGTGATCGATCAAATTAAGGCGGAGGTCGACAAAGCTTGCGGATACTCACTTGTATCANGTG
CCGACATNTTGGCCGTCGCAGCCCGTGACTCGGTAGTTGCG
GTATGTCTTATCTTANTGNTACATATGATGCCTTCATTTAAGCAAAACTACAGTGCAGACAAATAGAAGAGAGAGTCTC
CCGCTAATTGAACACGCTAGGCGTAGAATCATATGCACATACATAATCTTTCGATTATCTAAGCAAAGCTGAATTTGAACTTAAAAGGTTGACTGAAATATTTCAGCTGGGAGGGCCTTC
ATGGGAAGTACAACTTGGAAGGAGGGACTCGACCACGGCGAGCAGGACAACCGCCAACTCCGACATTCCCGCGCCGAACATGGACTTGCCTGCACTGATCAACACGTTCCAAAAGCAAGG
TCTCGACACTCGGGACTTGGTCGCGCTGAGCGGTGCTCACACAATCGGGTTCGCTCAATGTGTCAATTTCAGAAACCGCACATACAACGACGACAACATCGCCACCAGTTTTGCCAGGAG
CCTCCGGTCTTTGTGCCCGCGTACTGGAGAGGACGGGAACCTCGCTGGTTTGGATCCTTCGCCGGCTCAATTCGATGCATTGTACTTCCATAATCTGCTGGCGCAGAAGGGGCTTCTTCA
TTCTGATCAGGCGCTTTACAGTGGTGGGTCAACGGATGAGCTGGTGAAAACTTACAGTGATGATGCGGAGGCCTTTTGGGATGATTTTGCAAAGTCGATGATCAAGATGGGAAACATAAA
GCCGTTGATCGGAAACCAGGGCCAGATTCGCTCAAATTGCCGAAGGTTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTAAATAGCCTCAGCCTCGTCCAAGCACTTCTCTTCTTGTCTCTCGCGACCTCGGCTTTCTCGACGCGGCCCTACAAGGAAGGCCTCACGCCATACTTCTACGACTACGTTTGC
CCTCAAGCCTTGCCCGCCATCAAACGCGTTGTCGAGGCAGCGGTGCAACAGGAGCGACGCATGGGCGCTTCGTTACTCCGTTTGCACTTCCACGATTGTTTCGTTAAC
GGTTGCGATGCT
TCAATACTTTTGGATCCGACCCCNACCATTGACAGCGAAAAGCTCGCAGTCCCGAATAACAATTCGGCTAGAGGGTTCGAAGTGATCGATCAAATTAAGGCGGAGGTCGACAAAGCTTGC
GGATACTCACTTGTATCANGTGCCGACATNTTGGCCGTCGCAGCCCGTGACTCGGTAGTTGCG
CTGGGAGGGCCTTCATGGGAAGTACAACTTGGAAGGAGGGACTCGACCACGGCGAGC
AGGACAACCGCCAACTCCGACATTCCCGCGCCGAACATGGACTTGCCTGCACTGATCAACACGTTCCAAAAGCAAGGTCTCGACACTCGGGACTTGGTCGCGCTGAGCGGTGCTCACACA
ATCGGGTTCGCTCAATGTGTCAATTTCAGAAACCGCACATACAACGACGACAACATCGCCACCAGTTTTGCCAGGAGCCTCCGGTCTTTGTGCCCGCGTACTGGAGAGGACGGGAACCTC
GCTGGTTTGGATCCTTCGCCGGCTCAATTCGATGCATTGTACTTCCATAATCTGCTGGCGCAGAAGGGGCTTCTTCATTCTGATCAGGCGCTTTACAGTGGTGGGTCAACGGATGAGCTG
GTGAAAACTTACAGTGATGATGCGGAGGCCTTTTGGGATGATTTTGCAAAGTCGATGATCAAGATGGGAAACATAAAGCCGTTGATCGGAAACCAGGGCCAGATTCGCTCAAATTGCCGA
AGGTTGAAC

Retrieve as FASTA