Entry information : EguPrx38
Entry ID 11503
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx38
Name EguPrx38
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx38
start..stop
S start..stop
EgrPrx38 660 0 1..321 1..321
EgrPrx35 653 0 1..321 1..321
EguPrx41 652 0 1..321 1..321
EguPrx35 651 0 1..321 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11893..12114 222 N° 2 12233..12427 195 N° 3 12566..13111 546  
join(11893..12114,12233..12427,12566..13111)


exon

Literature and cross-references EguPrx38
Protein sequence: EguPrx38
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (300)
PWM (Da):   %s   35067.85 (32862.6)  
PI (pH):   %s   9.23 (9.23) Peptide Signal:   %s   cut: 22 range:22-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFLTLFQALLILSLAASTLSTRPYKNGLTPYFXDYVCPQALPAIKRVVEGAVQQERRMGASLLRLHFHDCFVNGCDGSILLDSTATIESEKFAAPNNNSARGFEVIDQIKAEVDRVCGRPVVSCADILAVTARDSVVALGGPSWKVQLGRRDSTTASRTTANNDIPAPNMDLPALINNFKRQGLKVKDLVALSGAHTIGFAQCFTFRNRTFNDSNINQAFAKNLRSYCPRTGSDSNLASLDPTPARFDTLYYNNLLTQKGLLHSDQALSTGESALELVKSYSYNYEAFWKDFAKSMVRMGNIKPLTGNQGQIRSNCRRVD

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Scaffold_1_752 (11893..13111) .
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCCTCACCCTCTTCCAAGCGCTTCTCATCTTGTCCCTCGCGGCCTCAACTCTTTCAACTCGTCCTTACAAGAATGGCCTCACGCCATACTTCTANGACTACGTTTGCCCTCAA
GCCTTGCCTGCCATCAAGCGCGTCGTTGAGGGGGCAGTGCAGCAAGAGCGACGCATGGGCGCTTCCTTGCTGCGCTTGCACTTTCACGACTGTTTCGTCAAT
GTAAGACATATGTGCCAG
CTAACTTTCACATTAATCTGTTCTCAAAAATACTGATTACTATTCAGTGTAACACAAGATTTGCCAACATTGATTTATGTTTGGGTGTTGAATGATGCAGGGTTGTGATGGATCGATACT
CTTGGATTCAACCGCAACCATCGAGAGTGAAAAGTTCGCGGCTCCTAATAACAATTCGGCCAGAGGTTTCGAAGTGATCGACCAAATAAAGGCGGAGGTTGACAGAGTATGTGGACGTCC
CGTGGTTTCTTGTGCAGACATCTTGGCTGTCACCGCTCGTGACTCTGTCGTTGCG
GTACGTCTAGTTTTACTGCATCCCGCGATGACCATTAATCAGCAAATCTAAATGGAGACCATCAT
TTGCTTAGTTGATTTTCATGCGCCGTAAGACATTGCCAATCCGAATTAGGTGTTAACTTCTTTCATATTTCAGTTAGGAGGGCCTTCGTGGAAAGTACAACTCGGACGAAGAGATTCGAC
GACGGCGAGCAGGACGACGGCAAACAACGACATCCCTGCACCGAACATGGACTTACCCGCCTTAATTAACAATTTCAAGAGACAAGGCCTGAAGGTCAAGGACTTGGTCGCGCTGAGCGG
CGCTCACACAATCGGCTTTGCACAGTGCTTTACCTTCAGGAATAGGACATTCAATGACAGCAACATCAACCAGGCATTCGCAAAGAATCTCCGGTCCTACTGCCCGCGCACAGGAAGCGA
CTCTAACCTCGCAAGTTTAGATCCCACGCCTGCGCGTTTCGACACATTGTACTACAATAACCTGTTGACCCAGAAGGGCCTTCTTCACTCTGATCAGGCACTGTCAACTGGTGAATCCGC
ACTCGAGCTAGTGAAGAGCTATAGCTACAATTATGAAGCATTTTGGAAGGATTTCGCTAAATCGATGGTCAGGATGGGAAATATCAAGCCACTGACCGGAAACCAAGGTCAAATTCGCTC
GAATTGCCGGAGGGTGGAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCCTCACCCTCTTCCAAGCGCTTCTCATCTTGTCCCTCGCGGCCTCAACTCTTTCAACTCGTCCTTACAAGAATGGCCTCACGCCATACTTCTANGACTACGTTTGCCCTCAA
GCCTTGCCTGCCATCAAGCGCGTCGTTGAGGGGGCAGTGCAGCAAGAGCGACGCATGGGCGCTTCCTTGCTGCGCTTGCACTTTCACGACTGTTTCGTCAAT
GGTTGTGATGGATCGATA
CTCTTGGATTCAACCGCAACCATCGAGAGTGAAAAGTTCGCGGCTCCTAATAACAATTCGGCCAGAGGTTTCGAAGTGATCGACCAAATAAAGGCGGAGGTTGACAGAGTATGTGGACGT
CCCGTGGTTTCTTGTGCAGACATCTTGGCTGTCACCGCTCGTGACTCTGTCGTTGCG
TTAGGAGGGCCTTCGTGGAAAGTACAACTCGGACGAAGAGATTCGACGACGGCGAGCAGGACG
ACGGCAAACAACGACATCCCTGCACCGAACATGGACTTACCCGCCTTAATTAACAATTTCAAGAGACAAGGCCTGAAGGTCAAGGACTTGGTCGCGCTGAGCGGCGCTCACACAATCGGC
TTTGCACAGTGCTTTACCTTCAGGAATAGGACATTCAATGACAGCAACATCAACCAGGCATTCGCAAAGAATCTCCGGTCCTACTGCCCGCGCACAGGAAGCGACTCTAACCTCGCAAGT
TTAGATCCCACGCCTGCGCGTTTCGACACATTGTACTACAATAACCTGTTGACCCAGAAGGGCCTTCTTCACTCTGATCAGGCACTGTCAACTGGTGAATCCGCACTCGAGCTAGTGAAG
AGCTATAGCTACAATTATGAAGCATTTTGGAAGGATTTCGCTAAATCGATGGTCAGGATGGGAAATATCAAGCCACTGACCGGAAACCAAGGTCAAATTCGCTCGAATTGCCGGAGGGTG
GAT

Retrieve as FASTA