Entry information : EguPrx39
Entry ID 11504
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-11 (Christophe Dunand)
Peroxidase information: EguPrx39
Name EguPrx39
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx39
start..stop
S start..stop
EgrPrx39 665 0 1..323 1..323
EgrPrx33 654 0 1..323 1..323
EgrPrx36 652 0 1..323 1..323
EguPrx36 647 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2605..2832 228 N° 2 2311..2505 195 N° 3 1580..2125 546  
complement(join(1580..2125,2311..2505,2605..2832))


exon

Literature and cross-references EguPrx39
Protein sequence: EguPrx39
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   34977.46 (32599.2)  
PI (pH):   %s   5.68 (5.68) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALNSLSLVQALLFLSLATSAFSTRPXKEGLTPYFYDYVCPQALPAIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDASILLDPTPTIDSEKFANPNNNSARGFEVIDQIKAEVDKACGYSLVSCADILAVAARDSVVALGGPSWEVQLGRRDSTMASRTTANSDIPAPNMDLPALINTFQKQGLDTRDLVALSGAHTIGFAQCFTFRNRTYNDDNIATSFARSLRSLCPRTGEDGNLAGLDPSPAQFDALYFHNLLAQKGLLHSDQALYSGGSTDELVKTYSDDAEAFWDDFAKSMIKMGNIKPLIGNQGQIRSNCRRLN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
scaffold_1_753 (2832..1580)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTAAATAGCCTCAGCCTCGTCCAAGCACTTCTCTTCTTGTCTCTCGCGACCTCGGCTTTCTCGACGCGGCCCTANAAGGAAGGCCTCACGCCATACTTCTACGACTACGTTTGC
CCTCAAGCCTTGCCCGCCATCAAACGCGTTGTCGAGGCGGCGGTGCAACAGGAGCGACGCATGGGCGCTTCCTTACTCCGTTTGCACTTCCACGATTGTTTCGTTAAC
GTACGACACATT
CACGATAATCTTATATTCGCATTGGTTATCTAGGAGCCGGCATAAATTTGCTAACTTGATTCTTGTTTTATCCACGTCATAATGTAGGGTTGCGATGCTTCAATACTTTTGGATCCGACC
CCTACCATTGACAGCGAAAAGTTCGCGAACCCGAATAACAATTCGGCTAGAGGGTTCGAAGTGATCGATCAAATTAAGGCGGAGGTCGACAAAGCTTGCGGATACTCACTTGTATCATGT
GCCGACATCTTGGCCGTCGCAGCCCGTGACTCGGTAGTTGCG
GTATGTCTTATCTTAATGCTACATATGATGCCTTCATTTAAGCAAAACTACAGTGCAGACAAATAGAAGAGAGAGTCT
CCCGCTAATTGAACACGCTAGGCGTAGAATCATATGCACATACATAATCTTTCGATTATCTAAGCAAAGCTGAATTTGAACTTAAAAGGTTGACTGAAATATTTCAGCTGGGAGGGCCTT
CATGGGAAGTGCAACTTGGAAGGAGGGACTCGACCATGGCGAGCAGGACAACCGCCAACTCCGACATTCCCGCGCCGAACATGGACTTGCCTGCACTGATCAACACGTTCCAAAAGCAAG
GTCTCGACACTCGGGACTTGGTCGCGCTGAGCGGTGCTCACACAATCGGGTTCGCTCAATGTTTCACTTTCAGAAACCGCACATACAACGACGACAACATCGCCACCAGTTTTGCCAGGA
GCCTCCGGTCTTTGTGCCCGCGTACTGGAGAGGACGGGAACCTCGCTGGTTTGGATCCTTCGCCGGCTCAATTCGATGCATTGTACTTCCATAATCTGCTGGCGCAGAAGGGGCTTCTTC
ACTCTGATCAGGCGCTTTACAGTGGTGGGTCAACGGATGAGCTGGTGAAAACTTACAGTGATGATGCGGAGGCCTTTTGGGATGATTTTGCAAAGTCGATGATCAAGATGGGAAACATAA
AGCCGTTGATCGGAAACCAGGGCCAGATTCGCTCAAATTGCCGAAGGTTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTAAATAGCCTCAGCCTCGTCCAAGCACTTCTCTTCTTGTCTCTCGCGACCTCGGCTTTCTCGACGCGGCCCTANAAGGAAGGCCTCACGCCATACTTCTACGACTACGTTTGC
CCTCAAGCCTTGCCCGCCATCAAACGCGTTGTCGAGGCGGCGGTGCAACAGGAGCGACGCATGGGCGCTTCCTTACTCCGTTTGCACTTCCACGATTGTTTCGTTAAC
GGTTGCGATGCT
TCAATACTTTTGGATCCGACCCCTACCATTGACAGCGAAAAGTTCGCGAACCCGAATAACAATTCGGCTAGAGGGTTCGAAGTGATCGATCAAATTAAGGCGGAGGTCGACAAAGCTTGC
GGATACTCACTTGTATCATGTGCCGACATCTTGGCCGTCGCAGCCCGTGACTCGGTAGTTGCG
CTGGGAGGGCCTTCATGGGAAGTGCAACTTGGAAGGAGGGACTCGACCATGGCGAGC
AGGACAACCGCCAACTCCGACATTCCCGCGCCGAACATGGACTTGCCTGCACTGATCAACACGTTCCAAAAGCAAGGTCTCGACACTCGGGACTTGGTCGCGCTGAGCGGTGCTCACACA
ATCGGGTTCGCTCAATGTTTCACTTTCAGAAACCGCACATACAACGACGACAACATCGCCACCAGTTTTGCCAGGAGCCTCCGGTCTTTGTGCCCGCGTACTGGAGAGGACGGGAACCTC
GCTGGTTTGGATCCTTCGCCGGCTCAATTCGATGCATTGTACTTCCATAATCTGCTGGCGCAGAAGGGGCTTCTTCACTCTGATCAGGCGCTTTACAGTGGTGGGTCAACGGATGAGCTG
GTGAAAACTTACAGTGATGATGCGGAGGCCTTTTGGGATGATTTTGCAAAGTCGATGATCAAGATGGGAAACATAAAGCCGTTGATCGGAAACCAGGGCCAGATTCGCTCAAATTGCCGA
AGGTTGAAC

Retrieve as FASTA