Entry information : EguPrx44
Entry ID 11506
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: EguPrx44
Name EguPrx44
Class Class III peroxidase     [Orthogroup: Prx030]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx44
start..stop
S start..stop
EglPrx44 631 0 1..307 27..333
EgrPrx44 630 0 1..307 27..333
EcamPrx44 622 0 3..307 25..329
PtPrx08 504 0 3..306 29..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15361..15516 156 N° 2 15672..15866 195 N° 3 16088..16253 166 N° 4 16556..16959 404
join(15361..15516,15672..15866,16088..16253,16556..16959)


exon

Literature and cross-references EguPrx44
Protein sequence: EguPrx44
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   307
PWM (Da):   %s   33634.38  
PI (pH):   %s   4.82
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CIGSSELQSNYYAESCPNAEEIIKQXVAKLYDEHGNTAISWIRNLFHDCMVQSCDASLLLESKHGNGIVSEQASSRSFGMRNFKYVTEIKEALEKECPATVSCADIIALSARDGTVLLGGPRIEMRSGRRDGRESHASVVEEFIPNHNDSMALVLSRFESVGIDAEGTVALLGAHSVGRVHCVNLYDRLYPTVDPTLDSDYAEYLKGRCPMPDPNPEKVRYSRNDRETPMVLDNMYYKHLLAXKGLLLVDQQLASDPTTAPFVEKMAADNGYFQDQFXRAMLXLSENNPLTGDEGEIRKDCRYINA

Retrieve as FASTA  
Remarks Partial sequence from genomic (part of exon 1 is missing).
scaffold_1_1191 (15361..16959)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCATAGGTTCCAGTGAACTTCAGTCGAATTACTATGCCGAGAGCTGTCCGAACGCAGAAGAAATCATCAAACAAGNAGTCGCCAAGCTCTACGATGAACATGGCAATACCGCCATCTCC
TGGATTCGCAATCTCTTTCATGACTGCATGGTCCAA
GTACGTATATCTATCTATACACATGAACACACGCACAAACACTGCATGTATAGTCCTCAAATTAGTGTTGAAGCATGCTGAATT
ATCTTTCATCTTCTGGGTATCGAACGGAACTGATGTACGGCTCTCTGTCGCTGACCTCTACGAATCGCTAGTCCTGCGATGCCTCGCTCCTGCTAGAATCAAAGCACGGAAACGGGATCG
TGTCGGAGCAGGCATCTTCNAGGAGCTTCGGGATGAGGAATTTCAAGTACGTGACCGAGATCAAGGAGGCTCTAGAGAAGGAATGCCCCGCGACGGTCTCTTGCGCCGACATCATCGCCC
TCTCCGCGAGAGATGGCACCGTTCTC
GTAAGTGTTTCGATAATTCACTTTTACGCCATCTTTTTTTCTGCACGGCTTGCGTAAAACACGGAGCCTGCCAAAGGGACGGATCTTTTCGAAA
CTTCCACATGAAAATGATCTCGAAACCGACACAGACCAGCTTCCCAGTTCCCCGACAGAACTCGAGAATCATCAATNTCTGTGAAAGTAGCTTGATCTCCATACTATACGTCGGTTTGTT
TGTACAGTTAGGAGGACCGCGCATCGAAATGAGAAGTGGAAGGAGAGACGGCAGAGAAAGTCACGCGAGTGTGGTGGAAGAATTCATTCCTAACCATAATGATTCGATGGCGTTGGTGCT
TTCTCGTTTTGAATCTGTTGGCATCGATGCTGAAGGAACAGTCGCTCTCCTTG
GTAAGTGTTTGATATATGNAGTTCACCNAGTTCATGCNTCTTTGAACANGCCTTGTCCGTGTCTGGT
TTATTTAACTGGACCCGGGTATCCCAGACGATGTTGCTGTTCCGTAATAGAAAGATCGCTTCATGCATCATTTGATATAATCTCGTATGATGTATATCGGTTAGGGTTTATCTTGTTCAT
CGTTCTTAACGCATGATTTCTATCCAATATCGAAGTGGATTGTAGTAATAGAAATTCAGACTTTCAGCGATAAAACTTTTCCCATCTCATTAATTGGCATCGATTCGCTGATCAGGAGCT
CATTCGGTTGGTCGAGTTCATTGCGTCAACCTATACGACAGACTCTACCCAACCGTGGACCCAACCTTAGACTCGGACTACGCCGAATACCTGAAAGGCCGGTGCCCGATGCCAGACCCA
AACCCGGAGAAGGTGCGGTACTCGAGGAACGACAGAGAGACTCCGATGGTGCTGGACAACATGTACTACAAGCACCTGTTGGCTCANAAGGGACTGTTGCTGGTAGATCAGCAGTTGGCT
TCAGATCCAACAACCGCTCCCTTCGTGGAGAAGATGGCTGCCGACAACGGCTACTTCCAGGACCAGTTCNCGAGGGCCATGCTCNCGTTGTCCGAGAACAATCCTCTCACGGGAGATGAA
GGAGAAATTAGGAAGGACTGCAGATACATTAATGCAGTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCATAGGTTCCAGTGAACTTCAGTCGAATTACTATGCCGAGAGCTGTCCGAACGCAGAAGAAATCATCAAACAAGNAGTCGCCAAGCTCTACGATGAACATGGCAATACCGCCATCTCC
TGGATTCGCAATCTCTTTCATGACTGCATGGTCCAA
TCCTGCGATGCCTCGCTCCTGCTAGAATCAAAGCACGGAAACGGGATCGTGTCGGAGCAGGCATCTTCNAGGAGCTTCGGGATG
AGGAATTTCAAGTACGTGACCGAGATCAAGGAGGCTCTAGAGAAGGAATGCCCCGCGACGGTCTCTTGCGCCGACATCATCGCCCTCTCCGCGAGAGATGGCACCGTTCTC
TTAGGAGGA
CCGCGCATCGAAATGAGAAGTGGAAGGAGAGACGGCAGAGAAAGTCACGCGAGTGTGGTGGAAGAATTCATTCCTAACCATAATGATTCGATGGCGTTGGTGCTTTCTCGTTTTGAATCT
GTTGGCATCGATGCTGAAGGAACAGTCGCTCTCCTTG
GAGCTCATTCGGTTGGTCGAGTTCATTGCGTCAACCTATACGACAGACTCTACCCAACCGTGGACCCAACCTTAGACTCGGAC
TACGCCGAATACCTGAAAGGCCGGTGCCCGATGCCAGACCCAAACCCGGAGAAGGTGCGGTACTCGAGGAACGACAGAGAGACTCCGATGGTGCTGGACAACATGTACTACAAGCACCTG
TTGGCTCANAAGGGACTGTTGCTGGTAGATCAGCAGTTGGCTTCAGATCCAACAACCGCTCCCTTCGTGGAGAAGATGGCTGCCGACAACGGCTACTTCCAGGACCAGTTCNCGAGGGCC
ATGCTCNCGTTGTCCGAGAACAATCCTCTCACGGGAGATGAAGGAGAAATTAGGAAGGACTGCAGATACATTAATGCAGTC

Retrieve as FASTA