Entry information : EguPrx45
Entry ID 11507
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: EguPrx45
Name EguPrx45
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx45
start..stop
S start..stop
EgrPrx45 660 0 1..322 1..322
EglPrx45 660 0 1..322 1..322
EcamPrx45 650 0 1..318 1..318
EgrPrx43 621 0 1..322 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24821..25024 204 N° 2 25631..25822 192 N° 3 25918..26080 163 N° 4 26387..26793 407
join(24821..25024,25631..25822,25918..26080,26387..26793)


exon

Literature and cross-references EguPrx45
Protein sequence: EguPrx45
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (301)
PWM (Da):   %s   34650.51 (32468.2)  
PI (pH):   %s   8.64 (8.39) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKLLVXIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFHDCFVRGCEGSVLIDSTLSNTAEKDSPANNPSLRGFEVIDSAKARLETMCKGVVSCADILAFAARDSVEITGGFGYNVPAGRRDGRVSLAPETINLPLPSFNVNQLTQLFANKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQRCPQNNDSTLVVPMDPPSPNMMDTSYXQGILANRGLFTSDQTLLTNSATANQVTQNARNPFIWKKIFAAAMVKMGKIGVLTGSAGEXRANCRVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_1_1487 (24821..26793)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTANGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCNTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GTGAGTGAAAACCAATGACACTATCCCATCTTTTGT
TGTAGCTCTAATTGCAATTAATGTTTTCACCAAGGTCAACTAAAAGCGTCGACTAATTTTCTTTCCNTTTTCCTTTGGTTGTATTTTTGTATGCAGAATAATGTGTCAACTAAGAGTTCA
TTAATTCATTNCAATTTACGCCACTCACATGCCATACCCACGTGCCGGNCTCATATGTAGAACATGAATTGACTACTACAAGCTTTTATGTCAATGAAGTATCTTTCGATTAATTTAACG
GAACTGTCATGACCTAATTAATAGATATGATACGTCTACTAATTATATTGCACATTCNAATTGGAATATGATACATACATTTATTAAAAGTTAATTGCTTAACTAGATGTGCCTAAATGC
ATTTAACAAGTTTAGATATTTCCGTTGTGTCTGATGTGTTCATTATTCATCTACCNNAGCTGTCGCATTAATCATGCGCCATGCTGTAAATCTTGTTTAAATATGCTCCTTCTAAACTCA
ATGACCCTCACAGAAGTACCTTAGCTCTGTTTCGGGAATGGATTTCATTTGTGAGTTTNAAGAAACATCGCGTGCTTTGATCCATCTTAGGGTTGTGAAGGTTCCGTGCTCATCGACTCC
ACTCTGTCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAACTATGTGCAAAGGAGTTGTTTCCTGT
GCTGACATACTAGCCTTTGCAGCTAGAGATAGTGTGGAGATC
GTAATCCCGCAAACCCCTTAACTCTTTATATTTACCAACNTGAGCATAAGTTCATCATACTAATAAACATGAGNCGTT
CTGTTTTCTTTTTGTAGACGGGAGGCTTTGGGTACAATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTCCAGAGACTATAAACTTACCTCTCCCGTCTTTCAATGTCAATC
AACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GTAACTCTTCACTTAGAGCAGCAATCTATGAAATGTGGCTATTTAAGTCCAGATAAAAAA
TAGAACATCAAGATTATGTAGGAAAGAGTAANATTAGAGGAAAAAAATGCTCACAGNGACGAATATAAAGGAAAAAATCATACATGATACTATTCTCTTTTTGAAAGTGNGGTCCTAGAT
TTCTGTAATACTTGGCCCATTATGTGTTTGTAGGCAACTTACATTCTTGACTCCTCCCCAATTTCATAATCAGAAAAAGGAATATTTACATTAAAAAAAAAAAAACTCGCTTCATGCGTG
TCACAGGAGCGCATACNATCGGTCGGTCTCACTGCACTTCCTTCAACAATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGA
AGCAACGGTGTCCACAAAACAATGATTCGACCCTAGTTGTTCCAATGGACCCCCCTAGCCCGAACATGATGGATACAAGCTATTANCAGGGCATACTTGCGAATCGAGGCTTGTTCACAT
CAGACCAGACACTCCTCACAAACTCNGCAACTGCAAACCAAGTTACTCAAAATGCAAGAAATCCATTCATTTGGAAGAAAATTTTTGCCGCTGCAATGGTGAAGATGGGTAAAATCGGTG
TCTTGACAGGAAGTGCCGGGGAGATNCGAGCGAATTGCAGGGTCATCAATAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTANGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCNTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GGTTGTGAAGGTTCCGTGCTCATCGACTCCACTCTG
TCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAACTATGTGCAAAGGAGTTGTTTCCTGTGCTGAC
ATACTAGCCTTTGCAGCTAGAGATAGTGTGGAGATC
ACGGGAGGCTTTGGGTACAATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTCCAGAGACTATAAACTTACCTCTC
CCGTCTTTCAATGTCAATCAACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GAGCGCATACNATCGGTCGGTCTCACTGCACTTCCTTCAAC
AATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAAGCAACGGTGTCCACAAAACAATGATTCGACCCTAGTTGTTCCAATG
GACCCCCCTAGCCCGAACATGATGGATACAAGCTATTANCAGGGCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAGACACTCCTCACAAACTCNGCAACTGCAAACCAAGTTACT
CAAAATGCAAGAAATCCATTCATTTGGAAGAAAATTTTTGCCGCTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACAGGAAGTGCCGGGGAGATNCGAGCGAATTGCAGGGTCATC
AATAGC

Retrieve as FASTA