Entry information : EguPrx48
Entry ID 11509
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx48
Name EguPrx48
Class Class III peroxidase     [Orthogroup: Prx025]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx48
start..stop
S start..stop
EglPrx48 649 0 1..321 2..322
EgrPrx48 615 0 1..321 2..322
EcamPrx48 612 0 1..321 2..322
PpePrx32 459 2e-164 21..321 21..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7148..7348 201 N° 2 7732..8493 762  
join(7148..7348,7732..8493)


exon

Literature and cross-references EguPrx48
Protein sequence: EguPrx48
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (301)
PWM (Da):   %s   34098.22 (31933.9) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.29 (6.50) Peptide Signal:   %s   cut: 21 range:21-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VCKMKNVVLVLLFVLPLALADLRVGFYNSTCPQAESIVRQVIQKRFRADQSITAALLRMHFHDCFVRGCEASILIDSTATKPSEKTAGPNFSVRGYDIIDEAKKSLEAACPSTVSCADIITLATRDSVFLAGGPSYNVPTGRRDGLVSNPDEVDLPAPSLSVSEALQAFTAKGFTLTEMVTLLGGHSVGVAHCGLFEDRLSNFQGTGAPDPTMDSSLVAKLKGICGNXTSNDPTAFLDQSTSFIMDNQFYKQIMQKKGVLQIDQELAVDKSSAGIVSRFASDANSFKKSFASAMVKMGNVQVLTGNAGEIRRNCXAFNQPK

Retrieve as FASTA  
Remarks Partial sequence from genomic (start codon is missing). Scaffold_1_2076 (7148..8493)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTGTGCAAGATGAAGAACGTAGTACTAGTGCTTCTCTTCGTTCTTCCCCTCGCGTTGGCTGATTTGAGGGTTGGCTTCTACAATTCCACCTGCCCGCAAGCAGAATCCATCGTGAGGCAA
GTCATTCAGAAGAGATTCAGAGCCGATCAATCAATCACTGCCGCCTTGCTTCGCATGCATTTTCACGATTGTTTCGTGAGG
GTAAGTTACCGGCGTCTTCTGCCGANTGAACATGTAACT
TTGATATGTTATAGATTAAGGAAAATGACAATGTTAACTAAGTAGCTAGTTTATATATCAATATGTTAAAGCTATGTGACATGCTTTATTGTTACCATTCATCCAGAGTCTAGTAGCTAA
CGCAGCAATTGATATATCAATTCCATAATAACTAGCATTAGTCTTAATCATATTGAGTCGCATCAACTCAAACCTGTTAAAGCTCAACAAACATTANGTGAAAATTACTAGACGTTTAAG
AAGAATGATGTTGTGCTCGATTGATGGTGTCAGATAGGTCTGTCACCTCCATTTAACCATAAAAGCATGCCGCTCACATTTTTTTTGCCTCGTTTTCTTTATAGGGCTGTGAGGCATCCA
TCCTCATCGACTCCACCGCCACGAAGCCATCGGAGAAAACCGCTGGGCCGAACTTCTCTGTGCGAGGATATGACATCATTGATGAAGCCAAGAAGAGCCTTGAAGCCGCATGCCCTTCGA
CCGTCTCTTGCGCTGACATCATCACGCTGGCAACACGAGACTCCGTGTTCCTCGCCGGAGGGCCCAGCTACAATGTCCCTACCGGAAGGCGGGACGGTCTGGTTTCAAACCCGGATGAAG
TGGACTTGCCGGCACCCTCATTATCGGTATCTGAGGCGCTACAAGCTTTCACGGCTAAAGGGTTTACACTCACTGAAATGGTGACTCTTCTGGGCGGCCACTCCGTCGGAGTCGCTCACT
GTGGCTTGTTCGAAGACCGCCTTTCGAATTTCCAAGGCACTGGAGCTCCAGATCCAACGATGGACTCGAGCTTGGTCGCGAAGCTAAAGGGCATCTGCGGGAACNCGACAAGCAACGACC
CCACNGCGTTTTTGGACCAAAGCACGTCGTTCATTATGGATAACCAGTTCTACAAACAAATTATGCAGAAGAAAGGGGTGTTACAAATCGACCAGGAGCTCGCCGTGGACAAATCTAGCG
CCGGCATTGTTTCTAGGTTCGCGTCAGACGCGAACAGTTTCAAGAAGAGCTTCGCTAGTGCGATGGTGAAGATGGGAAATGTCCAGGTTCTCACTGGGAATGCCGGAGAGATAAGGAGGA
ATTGCNGGGCCTTCAATCAGCCCAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTGTGCAAGATGAAGAACGTAGTACTAGTGCTTCTCTTCGTTCTTCCCCTCGCGTTGGCTGATTTGAGGGTTGGCTTCTACAATTCCACCTGCCCGCAAGCAGAATCCATCGTGAGGCAA
GTCATTCAGAAGAGATTCAGAGCCGATCAATCAATCACTGCCGCCTTGCTTCGCATGCATTTTCACGATTGTTTCGTGAGG
GGCTGTGAGGCATCCATCCTCATCGACTCCACCGCCACG
AAGCCATCGGAGAAAACCGCTGGGCCGAACTTCTCTGTGCGAGGATATGACATCATTGATGAAGCCAAGAAGAGCCTTGAAGCCGCATGCCCTTCGACCGTCTCTTGCGCTGACATCATC
ACGCTGGCAACACGAGACTCCGTGTTCCTCGCCGGAGGGCCCAGCTACAATGTCCCTACCGGAAGGCGGGACGGTCTGGTTTCAAACCCGGATGAAGTGGACTTGCCGGCACCCTCATTA
TCGGTATCTGAGGCGCTACAAGCTTTCACGGCTAAAGGGTTTACACTCACTGAAATGGTGACTCTTCTGGGCGGCCACTCCGTCGGAGTCGCTCACTGTGGCTTGTTCGAAGACCGCCTT
TCGAATTTCCAAGGCACTGGAGCTCCAGATCCAACGATGGACTCGAGCTTGGTCGCGAAGCTAAAGGGCATCTGCGGGAACNCGACAAGCAACGACCCCACNGCGTTTTTGGACCAAAGC
ACGTCGTTCATTATGGATAACCAGTTCTACAAACAAATTATGCAGAAGAAAGGGGTGTTACAAATCGACCAGGAGCTCGCCGTGGACAAATCTAGCGCCGGCATTGTTTCTAGGTTCGCG
TCAGACGCGAACAGTTTCAAGAAGAGCTTCGCTAGTGCGATGGTGAAGATGGGAAATGTCCAGGTTCTCACTGGGAATGCCGGAGAGATAAGGAGGAATTGCNGGGCCTTCAATCAGCCC
AAG

Retrieve as FASTA