Entry information : EguPrx50
Entry ID 11510
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-03-10 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-10 (Achraf Jemmat)
Peroxidase information: EguPrx50
Name EguPrx50
Class Class III peroxidase    [Orthogroup: Prx059]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx50
start..stop
S start..stop
EgrPrx50 610 0 1..333 1..333
EglPrx52 610 0 1..333 1..333
EgrPrx52 607 0 1..333 1..333
EcamPrx50 606 0 1..333 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22978..23202 225 N° 2 23311..23502 192 N° 3 23630..23795 166 N° 4 24496..24911 416
join(22978..23202,23311..23502,23630..23795,24496..24911)


exon

Literature and cross-references EguPrx50
Protein sequence: EguPrx50
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (305)
PWM (Da):   %s   33813.88 (31072.4)  
PI (pH):   %s   4.87 (4.87) Peptide Signal:   %s   cut: 29 range:29-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGSSTPSSLTAVTLLAALLLFLNPSNAQLTANFYAKTCPSVSSIVQTVIQEALQSDPRITASLLRLHFHDCFVDGCDGSLLLDNSPTIKSEKDAAPNFKSARGFDVVDKIKAAIESACPGTVSCADILALAAQASVSLSEGPYWTVLLGRRDSLTANQAGANTSIPSPFDSYNNLVSKFSAVGLDITDLATLSGAHTFGRAQCKSFNPRLYNFTANGGPDPTINPWYLTNLRKLCPQNGDSSVLADLDPTTPNXXXXXXXXXXXXXEGLLLSDQELSSTSGAATISIVNSFSFDQSAFFESFARSIVNMGNISPLTGSNGEIRFNCRKVNW

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Short sequence are missing due to "n".
scaffold_1_2253 (22978..24911)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGTTCTTCTACTCCTTCCTCGCTGACGGCGGTGACCCTTCTCGCCGCATTGTTGTTGTTCCTCAATCCGTCGAACGCTCAACTGACTGCCAATTTTTATGCGAAGACATGCCCG
AGCGTGTCCAGTATTGTCCAAACCGTGATCCAGGAGGCCCTTCAATCTGACCCACGCATCACTGCCAGCCTCCTCCGTCTCCATTTCCACGATTGTTTCGTCGAC
GTGAGTCCCTAAGCT
AGATCAATTCCCATTAACAATGGTGCTCTCAATCTGATTACCAAGTAGCTAGTCACGCAACCTAATGTTTAAGCCTGACATGTGTGTTAAAAGGGGTGTGATGGATCGCTGCTGCTGGAC
AATAGCCCAACCATAAAGAGCGAGAAAGATGCAGCTCCGAATTTTAAGTCCGCAAGAGGGTTTGATGTCGTGGACAAGATCAAAGCGGCTATCGAGAGTGCTTGTCCAGGGACCGTGTCT
TGCGCCGACATTCTTGCCCTTGCTGCTCAAGCTTCCGTCTCTTTG
GTATATGTAGTTATAGTCAAAGAAACATAAACATAAATCTAAAGTATATTCAGGGTTCATTATTATAACTCACCC
TACTCAAATCATTATTGTATTTCTCTTGATTATCACTCTTACCAATTTGCAGTCAGAAGGTCCATATTGGACAGTGCTCTTGGGGAGGAGGGACAGCTTGACCGCGAACCAAGCCGGAGC
GAACACATCGATACCCTCCCCTTTTGATAGCTATAACAACCTCGTTTCCAAATTCTCTGCTGTTGGCTTGGACATCACCGACCTTGCTACACTTTCCG
GTAAAAAAGAACAATTGGACTT
GCATTTTAATACGAAACGTGCAACTGTAGATATTGATGCACAAAAAAGATTTATAGAGTGAGATGCTGGATTTTTGTCACATAATTTATCGGCACAAACATCTCTTCACTTTTGTTTAAC
ACATTCTAACTTCCTAATATGATCATAGTCTAAGATTAATTGTAATCTATTGACATGCCTGTCTGGTACATGGCCTATGCACGCCTCGTGCATAGGCCATGCACATCTACCAGAAGGAAT
TTTGGCTAAGGATTATTAATCTATAATTGAATAAGTAATTTGCCCTTGACTTGAGATCGATTGACATGCATGTGTTATGCCTAGGCCATGCCTGTATCGTACATGGGCCATGCACATCTA
CTAGAACGAATTTTGGCTAAGGATTAAGGATTTCTTTTTCATCACAGGAGTATGAATATCGGGAAAGATGGTATCAAAATTTGCAAGCCCCTCATGTACTTATCCAAGAAATGCTATGTT
TACATAATCAATATATTAAGTGATGTCGCAAATCGTTATTACTTATTCATATATCCACTAATGAGTTTGCTGCATATGTTTGGCATACAAATTCCGTTGAGCATTCCTAGCCTTGATCTA
TTCATCCATCTCCATAATTAAGCATCTGCAGATATTTGTTCTCTTAGCTAACTTTTCGTGCATACGACAATAAAACAGGAGCTCACACCTTCGGACGTGCACAGTGCAAGTCATTCAACC
CTAGGCTCTACAACTTCACCGCGAACGGTGGCCCTGATCCCACCATAAACCCGTGGTACTTGACCAATCTCCGGAAACTTTGCCCTCAGAATGGCGACAGTAGTGTCCTCGCCGACCTCG
ACCCGACAACCCCAAACTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNANGAAGGGCTTCTTCTGTCCGATCAAGAGCTGTCCTCCACAAGTGGCGCCGCAACAATTTCCATCG
TCAACAGCTTTAGCTTTGACCAGAGTGCCTTCTTCGAGAGCTTCGCTCGGTCGATAGTAAACATGGGAAATATTAGTCCTCTCACCGGAAGTAACGGGGAGATCCGGTTCAATTGTAGGA
AGGTCAATTGGAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGTTCTTCTACTCCTTCCTCGCTGACGGCGGTGACCCTTCTCGCCGCATTGTTGTTGTTCCTCAATCCGTCGAACGCTCAACTGACTGCCAATTTTTATGCGAAGACATGCCCG
AGCGTGTCCAGTATTGTCCAAACCGTGATCCAGGAGGCCCTTCAATCTGACCCACGCATCACTGCCAGCCTCCTCCGTCTCCATTTCCACGATTGTTTCGTCGAC
GGGTGTGATGGATCG
CTGCTGCTGGACAATAGCCCAACCATAAAGAGCGAGAAAGATGCAGCTCCGAATTTTAAGTCCGCAAGAGGGTTTGATGTCGTGGACAAGATCAAAGCGGCTATCGAGAGTGCTTGTCCA
GGGACCGTGTCTTGCGCCGACATTCTTGCCCTTGCTGCTCAAGCTTCCGTCTCTTTG
TCAGAAGGTCCATATTGGACAGTGCTCTTGGGGAGGAGGGACAGCTTGACCGCGAACCAAGCC
GGAGCGAACACATCGATACCCTCCCCTTTTGATAGCTATAACAACCTCGTTTCCAAATTCTCTGCTGTTGGCTTGGACATCACCGACCTTGCTACACTTTCCG
GAGCTCACACCTTCGGA
CGTGCACAGTGCAAGTCATTCAACCCTAGGCTCTACAACTTCACCGCGAACGGTGGCCCTGATCCCACCATAAACCCGTGGTACTTGACCAATCTCCGGAAACTTTGCCCTCAGAATGGC
GACAGTAGTGTCCTCGCCGACCTCGACCCGACAACCCCAAACTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNANGAAGGGCTTCTTCTGTCCGATCAAGAGCTGTCCTCCACA
AGTGGCGCCGCAACAATTTCCATCGTCAACAGCTTTAGCTTTGACCAGAGTGCCTTCTTCGAGAGCTTCGCTCGGTCGATAGTAAACATGGGAAATATTAGTCCTCTCACCGGAAGTAAC
GGGGAGATCCGGTTCAATTGTAGGAAGGTCAATTGGAGT

Retrieve as FASTA